KEGG   Tetrahymena thermophila: TTHERM_00583420Help
Entry
TTHERM_00583420   CDS       T01020                                 

Definition
Eukaryotic initiation factor 4E family protein
Orthology
K03259  
translation initiation factor 4E
Organism
tet  Tetrahymena thermophila
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TTHERM_00583420
Translation factors [BR:tet03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TTHERM_00583420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 201 aa AA seqDB search
MSMKLSRGYTFWFVSERVENKDNYVSQLKKIGSFSDVDDFWKYYQHMARPDKLPEGTTFY
CFTEGVMPMWEDAANVGGGRFQMRVKIKYSNRFWEDLLLGLIGNQCEFNSYINGISLQAK
DPQHIVIQIWVKDRNKNESIDTGIKNFIMSIYQLNEDSSIEYRDFAKQKNQVSKFINLIG
NLKNGYQRVQFFMEEKWNNNK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaagctttcaagaggatacaccttttggtttgtttccgaaagagttgaaaat
aaagataattatgttagttagcttaaaaaaattggatcatttagtgatgttgatgatttt
tggaaatattattagcatatggcaagacctgataaattaccagaaggtactactttttat
tgttttaccgaaggagttatgccaatgtgggaagacgctgcaaatgttggtggaggaaga
ttctaaatgagagttaaaattaaatattctaacagattttgggaagatttacttttagga
ttaattggaaatcaatgcgaattcaatagctacatcaatggtatttctcttcaagcaaaa
gatccttagcacattgttatttaaatttgggtgaaagatagaaataaaaacgaatctatt
gacacaggtattaaaaacttcataatgagtatttatcagttgaatgaagattcatctatc
gagtacagagattttgccaagcaaaaaaactaagtgagcaagtttattaatcttattgga
aatttaaaaaatgggtatcagagagtttaatttttcatggaagaaaaatggaacaataat
aaatga

DBGET integrated database retrieval system