KEGG   Tetrahymena thermophila: TTHERM_00591650Help
Entry
TTHERM_00591650   CDS       T01020                                 

Definition
Palmitoyl protein thioesterase containing protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tet  Tetrahymena thermophila
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TTHERM_00591650
  Lipid metabolism
   00062 Fatty acid elongation
    TTHERM_00591650
Enzymes [BR:tet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     TTHERM_00591650
Lipid biosynthesis proteins [BR:tet01004]
 Fatty acid synthase
  Component type
   TTHERM_00591650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 285 aa AA seqDB search
MNKIILTICLIGFAVASNPVAIFHGFGDACANPGMKSFTKQIAAGVNGAYVKCVEIGNGA
MSSVLMRFDKQVENACNSIKQDPNFQGKTINVLGLSQGGLIARGIIETCDFGGSVARLIS
IGGPQMGVATIPKCHKGIFCNILNGLVDDLVYTPLAQKTVGPAGYFRNPKHYNTYLKHSI
FLPIVNNERQVNQTYKDRFVALEKVQLTMFSKDSVIDPKETAWFSFYGTDGKTVVGIEQQ
DVFTQDLFGLKTVYDAGKVEFITIDGDHLRFSTEDIQNIYIPALQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaataagattattttaactatctgcttaattggcttcgcagttgcttcaaatcctgtc
gctatcttccacggtttcggtgatgcatgtgctaaccctggtatgaagtccttcactaag
taaattgctgctggtgttaatggagcatatgttaaatgtgttgaaattggaaacggtgct
atgtctagtgttcttatgagatttgataaataagtagaaaatgcttgcaatagtattaaa
caagaccctaacttttaaggtaaaacaattaatgtccttggattaagtcaaggtggtctt
atcgcaagaggtatcattgaaacttgtgactttggaggcagtgttgctcgtcttatttct
attggtggtcctcaaatgggtgttgctactattcctaaatgccataagggaattttctgt
aacatattaaatggccttgttgatgatcttgtttacactcctctcgcttaaaagactgtt
ggtcctgctggttacttcagaaaccctaagcattataacacttatttaaaacacagcatt
ttccttcctattgttaacaatgaaagataagtcaatcaaacttacaaggacagatttgtt
gccctcgaaaaagtttaattgactatgttcagcaaggactccgtcattgatcccaaggaa
actgcttggttctccttctatggaactgatggaaaaactgttgttggaatcgaataacaa
gatgttttcacctaggatttgtttggtttgaagacagtttatgatgctggtaaagtagaa
tttataactattgatggcgatcatttaagattctcaaccgaagacatccaaaatatttac
attcctgctctctaatga

DBGET integrated database retrieval system