KEGG   Tetrahymena thermophila: TTHERM_00591650Help
Entry
TTHERM_00591650   CDS       T01020                                 

Definition
(RefSeq) palmitoyl-protein thioesterase
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tet  Tetrahymena thermophila
Pathway
tet00062  Fatty acid elongation
tet01100  Metabolic pathways
tet01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    TTHERM_00591650
Enzymes [BR:tet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     TTHERM_00591650
Lipid biosynthesis proteins [BR:tet01004]
 Fatty acid synthase
  Component type
   TTHERM_00591650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Lipase_2 BAAT_C PGAP1
Motif
Other DBs
NCBI-GeneID: 7838720
NCBI-ProteinID: XP_001019974
TGD: TTHERM_00591650
UniProt: I7MFF5
AA seq 285 aa AA seqDB search
MNKIILTICLIGFAVASNPVAIFHGFGDACANPGMKSFTKQIAAGVNGAYVKCVEIGNGA
MSSVLMRFDKQVENACNSIKQDPNFQGKTINVLGLSQGGLIARGIIETCDFGGSVARLIS
IGGPQMGVATIPKCHKGIFCNILNGLVDDLVYTPLAQKTVGPAGYFRNPKHYNTYLKHSI
FLPIVNNERQVNQTYKDRFVALEKVQLTMFSKDSVIDPKETAWFSFYGTDGKTVVGIEQQ
DVFTQDLFGLKTVYDAGKVEFITIDGDHLRFSTEDIQNIYIPALQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaataagattattttaactatctgcttaattggcttcgcagttgcttcaaatcctgtc
gctatcttccacggtttcggtgatgcatgtgctaaccctggtatgaagtccttcactaag
taaattgctgctggtgttaatggagcatatgttaaatgtgttgaaattggaaacggtgct
atgtctagtgttcttatgagatttgataaataagtagaaaatgcttgcaatagtattaaa
caagaccctaacttttaaggtaaaacaattaatgtccttggattaagtcaaggtggtctt
atcgcaagaggtatcattgaaacttgtgactttggaggcagtgttgctcgtcttatttct
attggtggtcctcaaatgggtgttgctactattcctaaatgccataagggaattttctgt
aacatattaaatggccttgttgatgatcttgtttacactcctctcgcttaaaagactgtt
ggtcctgctggttacttcagaaaccctaagcattataacacttatttaaaacacagcatt
ttccttcctattgttaacaatgaaagataagtcaatcaaacttacaaggacagatttgtt
gccctcgaaaaagtttaattgactatgttcagcaaggactccgtcattgatcccaaggaa
actgcttggttctccttctatggaactgatggaaaaactgttgttggaatcgaataacaa
gatgttttcacctaggatttgtttggtttgaagacagtttatgatgctggtaaagtagaa
tttataactattgatggcgatcatttaagattctcaaccgaagacatccaaaatatttac
attcctgctctctaatga

DBGET integrated database retrieval system