KEGG   Tetrahymena thermophila: TTHERM_00624830Help
Entry
TTHERM_00624830   CDS       T01020                                 

Definition
Guanylate kinase family protein (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tet  Tetrahymena thermophila
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tet00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 229 aa AA seqDB search
MTDTSNISDFKSLIMNSVSRSLNTIFLSKAAFCQTKQKLNPLVLSGASGAGKGTLYGMLK
SRNPNLFDLSVSCTTRKPRPGEAHGVHYYFINHEEFQKEIDQDNFAEHCLVHGNFYGTLQ
KQVFSFMDKGKICVLDIDVQGAEKVHKKFPSWNYVFINVPSLKILEQRLRGRGTETEQQI
QTRLTNAVKEIDSKNKLGFYHEILNDTQDQAYNDLTTYLKKQYPGVPIN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacatcaaatatttctgactttaaaagcttaattatgaattccgttagcaga
tcattaaatactatattcttgagcaaagctgctttctgctaaaccaagcaaaaattaaat
cccttagttttatctggtgcttctggagcaggaaaaggaacactttatgggatgcttaaa
agtagaaaccctaatttatttgacttaagtgttagttgcaccactagaaaacccagacct
ggtgaagctcatggagttcattattacttcattaaccatgaagaattttaaaaggaaatt
gactaagataactttgcagaacactgtttagtacatggcaatttttatggtactttacaa
aaacaagttttttcatttatggataaaggaaaaatatgtgtacttgatattgatgtttaa
ggagctgaaaaagtacacaaaaaattccctagctggaattacgtatttatcaatgtacca
tcattgaaaatcttagaataaagattgagaggaagaggtactgaaactgagcaataaatt
taaactagattaactaatgcagtaaaagaaatagattctaaaaataaactaggtttctat
catgaaattcttaatgacacataagatcaggcatataacgatttaacaacttatcttaaa
aaataatatcctggtgttcctataaactga

DBGET integrated database retrieval system