KEGG   Tetrahymena thermophila: TTHERM_00630010Help
Entry
TTHERM_00630010   CDS       T01020                                 

Definition
Glutathione peroxidase family protein (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tet  Tetrahymena thermophila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tet00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tet00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 175 aa AA seqDB search
MNGSEQIQSEATSLYDLSANNINGENTPLKNFNNKKAIIVVNVACQCGLTSDHYTQLVQL
YKQYKSQGLEILGFPCNQFGAQEPWAESEILSYTQKTFNVEFPLFSKIDVNGENTHPVYK
YLRRNSELFQNNAATKIPWNFAKFLVDGKTGKVVQYFSPKVNPVEMEQQIKQLLL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaacggttcagaacaaattcagagcgaagccacaagcttatatgatctttcagccaat
aacatcaatggtgagaatactcctttaaaaaatttcaataacaaaaaagctatcatcgtt
gttaatgttgcttgctagtgtggtttaacttctgatcattatacctaattagtctaatta
tacaagcaatataaatcttaaggtttagaaattttaggtttcccctgcaaccaatttgga
gcataagaaccttgggctgagtctgaaatcctttcatatactcaaaagacattcaacgta
gaattccctcttttctctaagattgatgtaaatggagaaaatactcatcctgtttacaaa
tacttaagaagaaattcagaattattctaaaataatgctgcaactaaaataccttggaat
tttgctaaatttttagttgatggaaagacaggtaaagttgtttaatatttcagcccaaaa
gttaatcccgtagaaatggaatagtaaattaaatagctattactttga

DBGET integrated database retrieval system