KEGG   Tetrahymena thermophila: TTHERM_00633280Help
Entry
TTHERM_00633280   CDS       T01020                                 

Definition
D-amino acid oxidase, putative (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
tet  Tetrahymena thermophila
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHERM_00633280
   00330 Arginine and proline metabolism
    TTHERM_00633280
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TTHERM_00633280
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    TTHERM_00633280
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    TTHERM_00633280
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     TTHERM_00633280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 182 aa AA seqDB search
MKVYHLDSIDYIKNSVPKEIFNDFKQVQVSWGNGKYYDAFTFTTVLIEGDIFLKELFNEC
KKQGVNFVNKHLNDEGEVTELPHDYIFNCAGIHSGKLFNDKNVYPIKGQLAVFRHTKGVD
YYLSAPGPNGSRVTVYPHSTGTACGITHERDVWDQRPTLSICSVVAKNAQDFFKDKAVQP
RL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttatcatttagatagtattgattatattaagaattctgttcccaaagagatt
tttaatgactttaagcaagtctaagtaagctggggaaatggaaaatactatgatgcattt
actttcacaacagttttaattgaaggtgacattttcttgaaagaattattcaatgaatgc
aaaaaataaggtgtaaattttgttaataaacacttaaatgacgaaggagaagttactgaa
ctacctcatgactacatctttaactgtgctggtattcactcaggaaaactctttaatgat
aaaaatgtttatcccatcaaaggttaattggctgttttcagacatacaaagggggttgat
tactatttgagtgctcctggccctaatggcagcagagtaactgtttatcctcattcaaca
ggcactgcttgtggtataacccatgaaagagacgtttgggatcaaagacctaccctttct
atatgctctgttgttgctaaaaatgcttaagatttctttaaagataaagctgttcaacca
agactttga

DBGET integrated database retrieval system