KEGG   Tetrahymena thermophila: TTHERM_00633360Help
Entry
TTHERM_00633360   CDS       T01020                                 

Definition
Core histone H2A/H2B/H3/H4 family protein
Orthology
K11252  
histone H2B
Organism
tet  Tetrahymena thermophila
Brite
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TTHERM_00633360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 122 aa AA seqDB search
MAPKKAPAAAAEKKVKKAPTTEKKNKKKRSETFAIYIFKVLKQVHPDVGISKKAMNIMNS
FINDSFERIALESSKLVRFNKRRTLSSREVQTAVKLLLPGELARHAISEGTKAVTKFSSS
TN
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaagctcccgctgccgctgctgaaaagaaggtcaagaaggcccccaca
accgaaaagaagaacaagaagaagagatcagaaaccttcgccatctacatcttcaaggtc
ttaaagcaagtccaccctgatgtcggtatttccaagaaggctatgaacattatgaactcc
ttcattaacgactccttcgaaagaatcgccttagaatcctctaagttggtcagattcaac
aagagaagaaccctctcatccagggaagtctaaaccgctgtcaagctcttattacccggt
gaactcgctagacacgccatctccgaaggtaccaaggccgtcaccaagttctcttcttct
accaactga

DBGET integrated database retrieval system