KEGG   Tetrahymena thermophila: TTHERM_00636900Help
Entry
TTHERM_00636900   CDS       T01020                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tet  Tetrahymena thermophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tet00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 336 aa AA seqDB search
MQPNSFELPISHALHGGYKHPACRNWVKQTLSANNLVYPVFVLDEPDAEQEIKTMPGIKR
FGYKKIVDHLKPLVKKGLQSIIIFGILSDDNKKDERGSHAGGNGIKGPTNLALEEIKKEI
PELLLIVDVCLCAFTSHGHCGLLNCEGYIDNAASLKRLVEVSISYVQSGAQVIAPSDMMD
GRIGAIKQELIRQNLEIPVMSYAAKFASSYYGPFRDACKSAPGKSDRQAYQLPLDSTQLA
LKAVQRDLEEGADYIMVKPITTYLDIVKEIKQRFNPIMACYHVSGEYAMVCFAAQNGACD
KKKVVLETMRSFRRAGIDIIITYFTPELLDWVKEEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaaatagctttgaattacctattagtcatgctttacacggtggatataagcat
cctgcttgcagaaattgggtaaaataaacactttctgctaataacctcgtatatcctgtc
tttgttttagatgaacctgatgctgaataagaaattaaaactatgccaggaattaaacgt
tttggatataaaaaaattgttgatcacttaaaacctttagttaaaaagggtttgtaatca
attattatttttggtattttgagtgatgataataagaaagacgaaagaggttctcatgct
ggtggaaatggaatcaagggacctacaaacttagctttagaagaaataaaaaaggaaatt
ccagaacttcttttgatagttgatgtttgtctttgcgcattcactagtcatggtcactgt
ggtttattaaattgtgaaggatatattgataatgctgcatctcttaaaagattggtagaa
gtaagtatttcttatgtataaagtggagcttaagttattgctccttctgatatgatggat
ggtagaattggagctattaaacaagaattaataagatagaatcttgaaattcctgttatg
tcatatgctgctaaatttgcttctagttattatggtccttttagagatgcatgcaagtct
gctccaggtaaatctgatagacaagcttattagctacctcttgattctacttaattggct
ttaaaagcagtttaaagagacttagaggaaggtgcagattatatcatggtaaagcctatc
actacttatttagatatagttaaagaaataaagcaaagatttaatcctattatggcttgc
tatcatgtcagtggtgagtatgctatggtctgttttgccgcttagaatggagcttgtgac
aagaaaaaggttgtattagagactatgagatcattcagaagagcaggaattgatataatt
attacttactttactccagagcttttagattgggtaaaagaagaattttga

DBGET integrated database retrieval system