KEGG   Tetrahymena thermophila: TTHERM_00636900Help
Entry
TTHERM_00636900   CDS       T01020                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tet  Tetrahymena thermophila
Pathway
tet00860  Porphyrin and chlorophyll metabolism
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TTHERM_00636900
Enzymes [BR:tet01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TTHERM_00636900
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTHERM_00636900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 7838958
NCBI-ProteinID: XP_001032351
TGD: TTHERM_00636900
UniProt: Q22HL3
AA seq 336 aa AA seqDB search
MQPNSFELPISHALHGGYKHPACRNWVKQTLSANNLVYPVFVLDEPDAEQEIKTMPGIKR
FGYKKIVDHLKPLVKKGLQSIIIFGILSDDNKKDERGSHAGGNGIKGPTNLALEEIKKEI
PELLLIVDVCLCAFTSHGHCGLLNCEGYIDNAASLKRLVEVSISYVQSGAQVIAPSDMMD
GRIGAIKQELIRQNLEIPVMSYAAKFASSYYGPFRDACKSAPGKSDRQAYQLPLDSTQLA
LKAVQRDLEEGADYIMVKPITTYLDIVKEIKQRFNPIMACYHVSGEYAMVCFAAQNGACD
KKKVVLETMRSFRRAGIDIIITYFTPELLDWVKEEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaaatagctttgaattacctattagtcatgctttacacggtggatataagcat
cctgcttgcagaaattgggtaaaataaacactttctgctaataacctcgtatatcctgtc
tttgttttagatgaacctgatgctgaataagaaattaaaactatgccaggaattaaacgt
tttggatataaaaaaattgttgatcacttaaaacctttagttaaaaagggtttgtaatca
attattatttttggtattttgagtgatgataataagaaagacgaaagaggttctcatgct
ggtggaaatggaatcaagggacctacaaacttagctttagaagaaataaaaaaggaaatt
ccagaacttcttttgatagttgatgtttgtctttgcgcattcactagtcatggtcactgt
ggtttattaaattgtgaaggatatattgataatgctgcatctcttaaaagattggtagaa
gtaagtatttcttatgtataaagtggagcttaagttattgctccttctgatatgatggat
ggtagaattggagctattaaacaagaattaataagatagaatcttgaaattcctgttatg
tcatatgctgctaaatttgcttctagttattatggtccttttagagatgcatgcaagtct
gctccaggtaaatctgatagacaagcttattagctacctcttgattctacttaattggct
ttaaaagcagtttaaagagacttagaggaaggtgcagattatatcatggtaaagcctatc
actacttatttagatatagttaaagaaataaagcaaagatttaatcctattatggcttgc
tatcatgtcagtggtgagtatgctatggtctgttttgccgcttagaatggagcttgtgac
aagaaaaaggttgtattagagactatgagatcattcagaagagcaggaattgatataatt
attacttactttactccagagcttttagattgggtaaaagaagaattttga

DBGET integrated database retrieval system