KEGG   Tetrahymena thermophila: TTHERM_00637650Help
Entry
TTHERM_00637650   CDS       T01020                                 

Definition
(RefSeq) ELP3 family histone acetyltransferase
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TTHERM_00637650
Transfer RNA biogenesis [BR:tet03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TTHERM_00637650
Chromosome [BR:tet03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TTHERM_00637650
   HAT complexes
    Elongator complex
     TTHERM_00637650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 569 aa AA seqDB search
MPNKDKIENKATIEKQKKPGKISGDDPVAVLKTISEIVSELINAYEKNEKINLTKVKSEL
SRKNKLSGTPKIVDIIAAIPEKYKNTLIPILKVKPVRTASGIAVVAVMCKPHRCPHIATT
GNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYIQTRDRVEQLKKLGHDVDKV
EFIIMGGTFMSLDASYRDYFIRNLHDALSGHRSHNVAEAIKFSDESRAKCIGITIETRPD
FCYQPHLSDMLLYGCTRIEVGVQSIYEDVARDTNRGHTIEAVKKCFRLSKDAGFKVVSHL
MPDLPNMGIERDLESFKEFFENPDFRTDGLKIYPTLVIRGTGLYELWKNGKYRNYNPNAL
VEIVAKLLALVPPWTRVYRIQRDIPMPLVTSGVDNGNLRELALQKMRDMNIPCRDVRTRE
VGIKEVHFKIKPEQIEFIRRDYFANDGWESFLAYEDPIQDTLVGLLRLRKCGASTFRPEL
TGNCSIVRELHVYGSIVPIHSRNPQKFQHQGYGTMLMEEAERISRDEHGSIKLAVIAGVG
TRHYYRKLGYHLEGPYMVKYLDGREQYVD
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcctaataaagataaaatagaaaataaggctactattgaaaagtagaagaagcctggt
aaaattagtggcgatgatcccgtagcagttttaaagactatctcagaaattgtctccgaa
ttaatcaatgcatatgaaaagaatgaaaaaattaatttaaccaaggttaagagtgaactc
tctagaaagaataaattaagcggtactcctaaaattgttgacattattgcagccatccct
gaaaaatataagaatactttaattcctattttgaaagtaaagccagtaagaactgctagt
ggtattgctgtcgttgctgtcatgtgtaagccacatagatgtcctcatatagccactaca
ggaaatatttgtgtttactgtccaggaggtcctgactctgattttgaatattccacatag
agttacactggttatgaacctacttctatgagagctattagagctagatataatccctac
atttaaactagagatcgtgtagaataattaaagaaattaggtcatgatgttgataaagta
gaattcattattatgggtggtacatttatgtcattagatgcaagctatagagattatttc
attcgtaacttgcacgatgccttgagtggtcatagatctcacaatgttgctgaagcaatt
aaattttctgatgaaagtagagctaaatgtattggtattactattgaaacaagacctgat
ttttgttattaacctcatctttctgacatgcttctatatggatgcacccgtattgaggtt
ggtgtctaatcaatttatgaagacgttgcaagagatactaatagaggtcatacaattgaa
gccgtcaaaaaatgctttagactttccaaggatgcaggcttcaaagtagtttcacattta
atgcctgatcttccaaatatgggtattgagagagatctcgaatcatttaaagaattcttt
gaaaatcctgatttccgtactgacggtttgaagatttatcccactttggttattcgtggc
acaggtttatacgagctttggaaaaatggaaaatacagaaactataatcccaatgcattg
gtagaaattgtagctaaattgttagctttggttcctccatggactagagtttacagaata
taaagagatattcctatgcctcttgttacaagtggtgtagataatggtaatttaagagag
ttggctttgtaaaaaatgagagacatgaacattccatgcagagatgtaagaactcgtgaa
gtaggtattaaggaagttcacttcaaaattaagcctgagtaaatcgaatttataagaaga
gactactttgctaacgatggttgggaatctttcctcgcatatgaagatcccatctaagat
acattggtaggtctgcttagacttagaaaatgtggagcttcaacttttagacctgaatta
actggaaattgctcaattgtaagagaattacacgtttatggctcaattgtgccaattcac
tcaagaaatccctaaaaattctagcatcaaggttatggtactatgttaatggaagaagcc
gaaagaatatcaagagatgaacacggttctataaaattggctgttattgctggtgttggt
actcgtcattattatagaaagcttggttaccacctcgaaggcccttacatggttaaatat
ttagatggaagagagtaatacgttgattga

DBGET integrated database retrieval system