KEGG   Tetrahymena thermophila: TTHERM_00637650Help
Entry
TTHERM_00637650   CDS       T01020                                 

Definition
histone acetyltransferase, ELP3 family protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TTHERM_00637650
Transfer RNA biogenesis [BR:tet03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TTHERM_00637650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 582 aa AA seqDB search
MPNKDKIENKATIEKQKKPGKISGDDPVAVLKTISEIVSELINAYEKNEKINLTKVKSEL
SRKNKLSGTPKIVDIIAAIPEKYKNTLIPILKVKPVRTASGIAVVAVMCKPHRCPHIATT
GNICVYCPGDLIKINVNFIIEKGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYIQTRDRV
EQLKKLGHDVDKVEFIIMGGTFMSLDASYRDYFIRNLHDALSGHRSHNVAEAIKFSDESR
AKCIGITIETRPDFCYQPHLSDMLLYGCTRIEVGVQSIYEDVARDTNRGHTIEAVKKCFR
LSKDAGFKVVSHLMPDLPNMGIERDLESFKEFFENPDFRTDGLKIYPTLVIRGTGLYELW
KNGKYRNYNPNALVEIVAKLLALVPPWTRVYRIQRDIPMPLVTSGVDNGNLRELALQKMR
DMNIPCRDVRTREVGIKEVHFKIKPEQIEFIRRDYFANDGWESFLAYEDPIQDTLVGLLR
LRKCGASTFRPELTGNCSIVRELHVYGSIVPIHSRNPQKFQHQGYGTMLMEEAERISRDE
HGSIKLAVIAGVGTRHYYRKLGYHLEGPYMVKYLDGREQYVD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcctaataaagataaaatagaaaataaggctactattgaaaagtagaagaagcctggt
aaaattagtggcgatgatcccgtagcagttttaaagactatctcagaaattgtctccgaa
ttaatcaatgcatatgaaaagaatgaaaaaattaatttaaccaaggttaagagtgaactc
tctagaaagaataaattaagcggtactcctaaaattgttgacattattgcagccatccct
gaaaaatataagaatactttaattcctattttgaaagtaaagccagtaagaactgctagt
ggtattgctgtcgttgctgtcatgtgtaagccacatagatgtcctcatatagccactaca
ggaaatatttgtgtttactgtccaggagatttaatcaaaattaatgtaaattttattatt
gaaaagggtcctgactctgattttgaatattccacatagagttacactggttatgaacct
acttctatgagagctattagagctagatataatccctacatttaaactagagatcgtgta
gaataattaaagaaattaggtcatgatgttgataaagtagaattcattattatgggtggt
acatttatgtcattagatgcaagctatagagattatttcattcgtaacttgcacgatgcc
ttgagtggtcatagatctcacaatgttgctgaagcaattaaattttctgatgaaagtaga
gctaaatgtattggtattactattgaaacaagacctgatttttgttattaacctcatctt
tctgacatgcttctatatggatgcacccgtattgaggttggtgtctaatcaatttatgaa
gacgttgcaagagatactaatagaggtcatacaattgaagccgtcaaaaaatgctttaga
ctttccaaggatgcaggcttcaaagtagtttcacatttaatgcctgatcttccaaatatg
ggtattgagagagatctcgaatcatttaaagaattctttgaaaatcctgatttccgtact
gacggtttgaagatttatcccactttggttattcgtggcacaggtttatacgagctttgg
aaaaatggaaaatacagaaactataatcccaatgcattggtagaaattgtagctaaattg
ttagctttggttcctccatggactagagtttacagaatataaagagatattcctatgcct
cttgttacaagtggtgtagataatggtaatttaagagagttggctttgtaaaaaatgaga
gacatgaacattccatgcagagatgtaagaactcgtgaagtaggtattaaggaagttcac
ttcaaaattaagcctgagtaaatcgaatttataagaagagactactttgctaacgatggt
tgggaatctttcctcgcatatgaagatcccatctaagatacattggtaggtctgcttaga
cttagaaaatgtggagcttcaacttttagacctgaattaactggaaattgctcaattgta
agagaattacacgtttatggctcaattgtgccaattcactcaagaaatccctaaaaattc
tagcatcaaggttatggtactatgttaatggaagaagccgaaagaatatcaagagatgaa
cacggttctataaaattggctgttattgctggtgttggtactcgtcattattatagaaag
cttggttaccacctcgaaggcccttacatggttaaatatttagatggaagagagtaatac
gttgattga

DBGET integrated database retrieval system