KEGG   Tetrahymena thermophila: TTHERM_00663840Help
Entry
TTHERM_00663840   CDS       T01020                                 

Definition
Histone deacetylase family protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TTHERM_00663840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 473 aa AA seqDB search
METKKRVAYFYNNEIGNYNYGKLHLMNPKRISMTHSLIVGYGVYKDLDVYTTREATKEEI
MQFHDQDYVEYLSNYVSSTKIDFLRKNGCTAPIIDEEAKNDVEKKRQYGIDVQADCPGFD
GVYTFSQLSTGGSIDAAHLIINNAADVAINWGGGLHHAKKGEAYGFCYVNDIVICILELL
KVFPRVLYIDIDVHHGDGVEEAFFTTNRVMTVSFHEFGEDFFPGTGGLNSSGEGLGKNYA
VNVPLRPGMDDESYKQLFKNVMNKVMEVFRPDVVVFQTGADSLANDKIGHFNLSIRGHGE
CLTYMLRFNVPVVVLGGGGYTIQNVSRCWAYETGLLVKKNLNGPIPVDDPFFHLYEKQNM
LHVPIQQVENKNSKEDLNKIQEEVFKQLKEVDAAPSIPFHNVPKAFQYDDDEYFEENEQD
QHHDFSGNTYNFNKLNDYINGYQTMEVEQNEEVGVYRKQPLLIEKNSSRFNHI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaaaaagagtagcttatttttacaataacgaaataggtaactacaactat
ggaaagttgcatttaatgaacccaaaaagaatttcaatgactcattccttgattgtaggt
tatggtgtctataaagatcttgacgtatacacaacaagagaagccaccaaagaagagata
atgcagtttcatgattaggattatgttgagtacctttctaactatgtatcgagtactaaa
atagattttctaagaaagaatggatgcactgctcctatcatagatgaggaagctaaaaat
gatgtagaaaaaaagagataatatggcatagatgttcaagctgattgtcctggctttgat
ggtgtctatacctttagccaactttcaacaggtggttcgattgatgcagctcacttaatt
ataaataatgctgcagatgtagctattaactggggtggtggattgcatcatgctaagaag
ggagaagcttatggcttctgttatgttaatgatatagtaatatgcattttggagctttta
aaagtatttcctcgtgtgctttacatagatatagatgtacaccatggagatggcgtagaa
gaggctttctttactacaaatagagtaatgacagttagttttcatgaatttggagaagat
ttctttcctggaacaggtggcctcaacagtagtggagaaggattgggcaaaaattatgct
gtgaatgtaccacttagacctggtatggatgatgaaagttataaataactatttaaaaat
gtaatgaataaagtaatggaagtgtttagacctgacgtagttgtattctaaactggagct
gatagtttagctaatgacaaaattgggcattttaatttatctattagaggacatggcgaa
tgcttgacttacatgctaaggtttaatgttcctgtagtagttttaggaggaggtggatat
actatttaaaatgtaagtcgttgctgggcatatgaaacaggattacttgttaaaaaaaat
ttaaatggacctatacctgttgatgatccctttttccatttatatgaaaaatagaatatg
cttcacgttccaatttagcaagtagaaaataagaatagtaaagaagatttaaataaaata
taagaagaggtctttaagcaactaaaagaagtagatgctgccccatcaataccttttcat
aatgttcccaaagcattctagtatgatgacgatgaatatttcgaggaaaatgaataagat
taacatcatgatttttctggaaatacttataatttcaataagcttaatgactatataaac
ggatattaaacaatggaggtcgaataaaatgaagaagttggagtatatagaaaacaacct
ctattaatagaaaagaatagtagtagatttaatcatatttga

DBGET integrated database retrieval system