KEGG   Tetrahymena thermophila: TTHERM_00666570Help
Entry
TTHERM_00666570   CDS       T01020                                 

Definition
Isoamylase N-terminal domain containing protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tet  Tetrahymena thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tet00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 686 aa AA seqDB search
MYIDSGDSLAQKTGSRKLIKKRSTFCPISKSSSSLDYEFNVKNFKIFDESPQLANYLPHF
EQRQLSFMECINQIFKSDYSLETFAQQYEQFGVQATPTGFSYKEYAPQAIEVYLTGDFNN
WATKQYPLVNDGTGIWNLNLPEGVVIEHGSRICAYVRTSKNQYLYRVPIGARYIKKLDVN
KKDDEFCEIFWNPPQKYAFQHIHPHKPRVFKIYRAEIGKQGPEKRNYTYKEFAQNELQRI
KDLGYNTILLVGLQEHESVGSTYSVVNPYSINSSAGTPDDLKQLVDKAHEVGLYVTMDIV
QTHASPEKGFNQWDGSHFSYFIDGEQGIHPQHGGRLFNFAKWETQRLLLSNLGYFLNEYK
IDGFRFVDVPSIIYKHHGQFKFSGNLDEYFGENSSIDGLVYLQLANETVHKINSNAVTFA
EDESDYPSLCFPLEQGGIGFDYRISIKAADEFANYLCESNKVDFNKLISLLDQRLNEEKV
ISSLCYKSSDIILKNIKHKIQQLQDGEVQKHLSLHKIARMIVISYGGDSYLNRYGNEFGS
SEEYFRSDLLGISPYKELLEFDRNLLKLEETHQILSMKEKSVTQKSDGILVFERADLIFV
FNLNEQSQSNFKIGTKWNSEHNIIFSTDDANFAGRARIGHNKIKVINEKVNTLIFRPFHL
VLDIPSHCGFILQPIDTEGFFEERKE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtacattgactccggtgactctttagcctaaaaaacaggatctcgtaaattgataaag
aagagatccacattctgtcctatttccaagagcagtagctctcttgattatgaattcaat
gttaagaatttcaagatttttgatgaaagcccacaactcgctaattacttgcctcatttc
gaataaagatagttaagttttatggaatgcattaattagatatttaaaagcgattattct
ctagaaactttcgcttaacagtatgagtagttcggtgtccaagcaactccaacaggtttt
tcttataaggaatatgcacctcaggcaattgaagtttatcttacaggagattttaataat
tgggcaactaaatagtatcctttagttaacgatggcacaggtatttggaacctaaatcta
cctgaaggagttgtgattgagcatggcagtagaatttgtgcatatgttagaacttctaaa
aattaatatctttatagagttcctattggtgcaagatatattaaaaaattagatgttaac
aaaaaagacgatgaattttgtgaaatattttggaatcctcctcaaaaatatgccttctag
cacattcatccccataagcctagagtttttaaaatttacagagctgaaataggaaagcaa
ggtcctgaaaaaagaaactacacatacaaagaatttgcctaaaatgagctataacgtata
aaagatttaggatataacacaattcttttggtaggattataagagcatgaatctgttgga
tctacttattcagttgtaaatccttattcaatcaattcttcagcaggtactccagacgat
cttaaataattggttgataaggctcacgaagttggcttgtatgtcaccatggatattgtt
taaactcatgcttcacctgaaaagggcttcaatcaatgggatggaagtcacttcagctat
tttattgatggagaataaggaatccatccttaacatgggggaagattatttaattttgca
aaatgggaaacttagagattattactatctaatttgggatactttttgaatgaatataaa
attgacggttttagatttgttgatgtaccatcaataatctataaacatcatggtcaattc
aagttttctggtaatttggatgaatattttggtgaaaacagctcgattgatggtttagtt
tatctttagttagcaaatgaaacagttcacaaaatcaattctaatgcagtaacatttgca
gaagatgagtcagattatccttctttgtgcttcccattagaataaggaggtatcggcttt
gattacagaatatctattaaagcagctgatgagttcgccaattacttgtgtgaatcaaat
aaagttgattttaataaattaatctctttgttagactaaagactcaatgaagaaaaggtt
atttcttctctttgctataagtcatcagatatcatcttaaagaacataaagcataaaatc
taataattataagatggtgaagtccaaaagcacctctcgttgcacaaaatagcaagaatg
attgttatttcatatggaggcgatagctacttaaacagatatggtaatgagtttggatca
tctgaggagtactttagatcagatttattaggaataagtccctacaaagaattattagaa
tttgataggaatttattaaaattggaagaaacacatcaaatactttcaatgaaagagaag
agtgttacacaaaaatctgatggaattttagtttttgaaagagcagatttgatatttgtc
tttaatttaaatgaatagagttagagtaacttcaaaataggaacaaagtggaactccgaa
cacaatataatatttagtactgacgatgctaattttgctggcagagcaagaattggtcac
aataaaataaaggttattaatgaaaaagttaatactctaatttttagacctttccatcta
gtacttgatattccttcacattgtggttttatactataacccatcgatactgaaggattt
ttcgaagaaagaaaggagtga

DBGET integrated database retrieval system