KEGG   Tetrahymena thermophila: TTHERM_00675710Help
Entry
TTHERM_00675710   CDS       T01020                                 

Definition
(RefSeq) cation channel family protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 7826435
NCBI-ProteinID: XP_001015043
TGD: TTHERM_00675710
UniProt: Q23DY9
AA seq 3315 aa AA seqDB search
MKQSTENNQNDEHGQQKSSKWIQKLKTIFENELPSSSKKKQKIKDKKVILQTQDSQTDDY
EENSDDVNSQDMSFLQNKKDKKKEQLKFLYEQIAAEMNQKDDGNNHDEEDLWDWMRNQNK
YEEKDSDEQLIHSFQEQEAEFLALKEKEEQNKFLDIVEMNEYQKIQKFNADTLPRKIFKQ
IWSIKNAISQICNIIINSKPFEYATLCVILFNCVILAMDDPTTNADDQQRLQIDLILLIL
YTVEMGFKILALGFIFNKGSYMRDMWNILDITIIITGYLPYVVNTSQVNLSAVRSLRVLR
PLRTISRIKALKQILNTLFSSFSLLKDAIIIIIFFYLVFAIAGQQLFTGCLKKRCFDSSN
GIQFGDNDQNVFLCIEDIDCYQYAESNSKIHYICGKGMVSPFWDTENFDTFGWALLNVYV
VVSQEGWSTIQAQVQQTFGYPSFIYFMICVLVGNMFLENLLMAIIQIKYEESERLLKKRQ
KAIEDVQSFNLADFIRWGIYKSNKQVYKELEEKKIKKVSTLSEIISFFKQGAQIKKLFTI
TKSKSNSGSPNNKDKQIEENIHNFKSIEELENQSADKNQAEKLGKEQKVQQQPANLGTQF
EQSKPLIEQELQEIHDQNLNTFKSQETNLNLLLKIPMIGLKESQLSVFNNYNSNFSPTYS
VAHFSHNIKQNQELANFTYEDQNLNLNKLQKSIHIKDLDQMANNQQSQFPKFNPIMKRQP
QYLKKSSIREKSPKRGYQRKNSRKMTTKKTMIIKPLEGTQTQIRNSVSNNNNTQIRLTVA
KNMNSSHQSRNPSEIHQNSQLNQTNFQRDKSVNQNTYISNNTYHQGSNQQTIMLQPSVIL
KSKQNRNSNVLNILNSQIIPARKVESDEGSSIDSHQNKDFDEEEQFFKEIEKTYEINQKL
NRQLELKETEDNQYIENIIKDRQIERNYRQKTVTLDNLINNQINKQPLHHDQLSLSSIQE
SYQKDTPEEQNLMFQSIQKRSFKKKREVSIQGQLQSSEISRPYDPESPKKAMSSKRIKQL
PNIPSASLNTSSKIQKSSHVSIILENSLNNSKQKQIRSASQTDFKVDSKQSILEQRKNSY
FYDGLFSDEDFDNVKQFRKQISKKTSIASKTGNNKNKKELQKKKSVKDKNVVDENPKVSI
INQVLSKDEGQLYRKLFLKKDVIARVLYKEPTNYDDDILPKEKLIKKEKKKQDRLDKLKK
MKFSISYQAEKRVKLRSQVVEEKKKKMEKMKFLPIKANRTALALIHQQPQVYPGGVNPLD
LAAAQNKIKSQTLIGQQNTQKNNHENMSQGTYNRAPSIVQQLLKQQTLILQKGKIDDEKV
RLQGDASQKNNLIPQSALSLEYFENQEKIKKGLNLIIPDSDKNSQSNTGSQQVIEANLIQ
KKGTLGNNDQSDQLLKANLTPKTAKGILKIKSITGNENSNLNTELNRSQTNKQLDESLLN
KKKTSGYTGNTGRHQGDNPAFEWDLIKAREMLFPTDHEEEEKSQRESEFSQVFGDNASIF
NSILDESKSKNSFNSSSFHQSYGTSSKFESSSMNSYSMKSQSKEGKSAFDETNADTASKR
SKYSKNKDDTNSKAQDSNKSKDGKEDKGNGENQDYFQKPQTLEQFLKEPLEKEYVQVVKQ
QVNNLIQKGQNKIKSYWSGDDVLVATKVYKQQQAIKTLMKCLNYPNTITEQNEGGFMGIV
NAFRRRVRMLVQTPLYENLIMIAVVMNTVILSLDGSVDNQSILDQFNQAFTYIFAIDMGL
KLIGLGFALYCADRMNIFDGLIVILSIFDIIFLSGSSGGSSFSAFRSLRILRVFRVLRVT
RLLRSLKFMKILIKVISSILDKLFYIILLLILYIFIYTLIGMQLYGGSFLSVSRSNRMVF
DSFLQASFSVYDLLTIENWNNILYVALRTQVNVGITCIYLISCIFIGNFIIMNLVLATMI
GAFNSSQFDKEKEEIANTVEIVEDLDLGHTTTLNSTTFMNMSNSQSRLGSSTHSFSVKNR
QRMLSSGGSSQGYSDEHSQNNHSQHSFSKKSQQIQKESFSREYKEKASSISDSHNQSLDN
KSSHNLELQIVSEQEQNNDKNNQKNMFKQQAVVKKDEDDEKEEIFLFFDNIKCQKSLYIF
SMQNKIRRAFYFIVKNPLFDNIILAGIILNSVKLVSDTYDTGSDSQKQASQILDIMFTVF
FSIESCLKIVSYGFFFDENSYLRDNWSKLDFFVVVTSIIDVSLQNGNFASLKILRLLRTL
RPLRVLHHNKSMKLIVTTLLESIVGILNMLLVIFLVWLMFAILGVSLMGGKLQYCNFPNN
GISYNIYKYNQSQCSRVGGSWQTYDLNFDNVPAALLNLFVISTFEGWPAYVFNYLDGSSD
GPVYFGSAYFSIYIVFFILVGSFFSIDLFGAVLSFHYDIALQKSKNKYLSSEQTQWIELQ
RLILQSKPDYNSISLPTNKFRKFIWNICESQKLEIFIMICIIGNIVSMALSYDTSPSSYD
TILQDINLGFSIVFITECLLKLIAYGFNGYFYKSSNQFDFFVVSVSVIDIIFTYSGNQFI
KFLSAGPQIARIFRVFRVTRLLRLIKQFEGLQKLMSTLIYALPSLTNATALLFLIYFIFA
ILACYLYSPYQTGNSLNSFQNFSTFHRSYLLLFRMSTGEDWYLIMFDIIHHTNMWSAFFF
VVFIIIQQYIMMSLFILIIIEQFENNYINPDNPINDFQYSEEDFKKQWVQFTRNSYGIKI
HERFITDFYFSILRPLGFDYKSKLKEFVEQVKTINQQVSEQDLELITGKFRIKQKQLAEK
EIMKMNIRCDYDGYIFYNELLYYFFKHSLYDSVFGRIDNASTKSEYEKCIKAEEILYKEE
HITRRKLRILKKKQAALTKQKFISSRQKEVNPMVRRLFVGMCFKSWLKYSQKIQNNIMQD
YDDISSQTDSDEEYDQLQVDPEDLQNALAIDKFYTSQDKEENIIEVLKNRRFIIPRLHTI
KLRKQDQKEQIADGFFNGKYFEFPNPDEIYKAELENEQNINEFEERINEQQKQLQIIKNN
EQNNKQMLSSVNSNYQERTKSIQRSQLNNQRNNTLKLSHAFNIPSKRTSIDVNNLNLIHS
NNLLSIQNVQSNNQLVPKDQTKLKLSLVESSNSLGMSVRKESIVKKDSHNVSTPKSQLNL
SQVKKLTLQKNNSNSPRLQVPLENNRQRKDSKSIFSMTPQNRANENENIEDKLNSQHLMH
LQATPITFTQFVNSKNFMSSPENESDDEHKQQIRLDLTKQQSSQIKSPKKEISRFGESSS
IINQLKQDFNINGHEKNNESNDKHSSIMNMPNLQQKSYSQQSDKHQAKIPIDNQEHKKPN
LNKNIPQIRINFEED
NT seq 9948 nt NT seq  +upstreamnt  +downstreamnt
atgaaatagtcaacagaaaataattaaaatgatgaacatggttaacaaaagtctagtaaa
tggatttaaaagttgaagacaatatttgaaaatgagcttccatctagctctaaaaagaaa
taaaaaattaaggataaaaaagtgatattatagacataagattcttagactgatgattac
gaggagaattcagacgatgttaattcataggacatgtcatttttgtaaaataaaaaagac
aaaaaaaaggaatagcttaaatttttatatgagcagattgcagctgagatgaattaaaaa
gatgatggaaataatcacgatgaagaggatttgtgggattggatgagaaattagaataaa
tatgaagaaaaggatagtgatgaataattaattcattccttttaagaataagaagcagaa
ttcttagctctaaaagaaaaagaagaataaaataaatttttagatatagtagaaatgaat
gagtactaaaaaatacaaaaattcaatgcagacactcttcccagaaaaatttttaagcaa
atatggtcaataaaaaatgcgatttcataaatttgcaatattatcataaacagcaaaccc
ttcgaatatgctacactatgtgttattttatttaattgcgtaatattagctatggatgat
cctacaactaatgctgatgattaatagagattataaattgatttaatcctacttattttg
tacactgttgaaatgggctttaagattttagctttaggttttatttttaataaaggttcc
tatatgagggacatgtggaatattttagatataactattattataactggttatttacca
tatgttgttaatactagttaagttaatttatctgcagtaaggtctttgagagttctaagg
cccttaagaacaatttcaagaattaaagctttaaaataaattcttaacactctcttcagc
tctttttctctgcttaaagatgccatcattattataatttttttctaccttgtttttgct
attgctgggtagcaactcttcacaggctgcttaaaaaagagatgttttgattctagtaat
ggcattcaatttggagacaatgatcagaatgtttttctttgcatcgaagatattgattgt
tattaatatgcagaaagcaattccaaaattcactatatatgtggaaaaggaatggtaagt
cctttctgggatactgaaaattttgatactttcggatgggccttgttaaatgtttatgtt
gtagtctctcaagaaggttggtcaaccatttaggcataggtttagtaaacttttggatat
ccttcattcatatattttatgatatgcgttttagtcgggaatatgtttttagaaaatctt
ttgatggctattatttaaattaaatacgaagaaagtgagcgtttgctcaaaaaaagataa
aaagctatcgaagatgttcaatctttcaatttagcagatttcatacgatggggaatttac
aaatcaaataagtaggtttacaaagaattagaggaaaaaaaaataaaaaaagtgtccact
ttaagcgaaattataagcttttttaagcaaggagctcaaattaaaaagttattcacaatt
acaaagtcaaaatctaacagtggaagtccaaacaataaagataaatagatagaagagaat
atacataacttcaagtcaattgaagaattagaaaattaatcagctgataaaaattaagct
gaaaaacttggaaaggaatagaaagtacagcagtaaccagctaatcttggtactcaattt
gaatagagtaaacctcttattgaataagagttataagaaattcatgattaaaatctaaat
acttttaaatcacaagaaactaatcttaatttgcttttaaaaatacctatgataggttta
aaagaatcttaattatctgtatttaataattataattctaacttttcccctacttacagt
gttgcacatttttctcataatattaagcagaactaagagttagctaattttacatatgaa
gatcaaaatctcaacttaaataagctctaaaagtcgattcacattaaagaccttgaccag
atggctaacaattaataatctcaattccctaaatttaacccaattatgaaaagacagcct
caatatctaaaaaaatcttcaattagagagaagtctccaaaaagaggttattaaaggaaa
aactcaagaaaaatgactacaaaaaaaacaatgattattaaacctttagaagggacataa
acataaataagaaacagcgttagtaataataataatacttaaattcgtttaacagttgcc
aaaaatatgaactcttcacattaaagtagaaatccgagtgaaatccattaaaactcttaa
ttaaattaaacaaatttctaaagagataaaagtgtcaatcaaaatacatacatttctaat
aatacttatcactaaggctctaattaacaaacaatcatgttacaaccaagtgtcatttta
aaatctaaataaaatagaaattcaaatgttttgaatattctaaattcctagataattcct
gccagaaaagtagaatcagatgaaggaagtagcattgatagtcactaaaacaaagatttt
gatgaagaggaataattctttaaagaaatagaaaaaacatacgaaataaattaaaagtta
aatcgttaacttgaactaaaagagactgaagataattaatatatagagaatattattaaa
gatagataaatcgaaagaaattacagataaaaaactgttacattagacaatttaattaat
aatcaaattaataaacaacctttgcatcatgattaattatccttaagtagcatttaagaa
agctaccaaaaagatacaccagaagaataaaacctaatgttttaatctatttaaaagaga
tcttttaagaaaaaaagagaagtttcaatttagggataattataaagttcagaaataagc
aggccatatgatcctgaatcacctaagaaagcaatgtccagcaaaagaataaaataattg
cctaatataccatctgccagtttaaatacatcttctaaaatttaaaagagcagtcacgtt
tctatcattttagaaaattctcttaacaattcaaagtaaaaataaatcagatctgcttca
taaactgattttaaagtcgattctaaatagagtattttagaataacgtaaaaatagctat
ttctatgatggtcttttttctgatgaagattttgacaatgtgaaataatttaggaaataa
atttctaagaaaactagcattgcaagcaaaacaggaaataacaaaaataagaaagaatta
taaaaaaagaaatctgtcaaggataaaaacgttgttgatgaaaacccaaaggtaagcatc
ataaattaagttttaagcaaagacgaaggtcaattatacagaaagttatttctaaagaaa
gatgtgatagccagagttttatacaaagaaccaaccaactacgatgatgatatcttacct
aaagaaaaattgatcaaaaaagaaaagaaaaagcaagatagattagataaactcaaaaag
atgaaattctcaatctcatatcaagctgaaaagagagttaaattaagaagctaagttgtt
gaggagaaaaaaaagaaaatggagaagatgaaatttttacctattaaggcgaatagaaca
gctttagctttaattcattaataaccataagtttatccaggtggagttaatcctttagat
cttgctgctgcataaaacaaaataaaatcacaaactttaatcggtcagtaaaatacttaa
aaaaacaatcatgaaaatatgagctaagggacatacaatagagcacctagcatagtgtaa
tagctattaaagcaataaactttaattttatagaaaggcaaaattgatgatgagaaagtt
agactgtaaggcgatgcatcttaaaaaaataatttgattccttagagtgctttgtcatta
gaatattttgaaaactaagaaaagataaaaaagggattgaatttaataattcctgattct
gataaaaacagttagtcaaatactggatcttaataagtaatagaagctaatttgatttaa
aaaaaaggaactttaggaaataatgattagtctgattagttattaaaagcaaatttaaca
cctaaaactgctaagggaatattgaaaattaaatcaataacaggcaatgaaaattctaat
ttaaacacagaattaaacagatcttagacaaataaatagcttgacgaaagtcttcttaat
aaaaagaaaacaagtggttatactggcaacactggcagacatcaaggtgataaccctgcc
tttgaatgggacctaattaaagcacgggaaatgcttttcccaactgatcacgaagaagaa
gaaaaatctcaaagagagagcgagtttagttaagtttttggagataatgcgagtattttt
aatagtattttagatgaaagtaaatcgaaaaatagttttaattcatccagctttcattaa
agttatggaacttccagtaaatttgaaagcagtagcatgaatagttattctatgaaaagt
cagtctaaagaaggcaaaagtgcttttgatgaaacaaatgctgatacagcaagtaaaagg
tcaaaatactctaaaaataaagatgacacaaattcaaaagcataagattcaaataaatca
aaagatggtaaagaagacaaaggtaatggagaaaattaagattattttcaaaagcctcaa
actttggagtaattcctaaaagagcctctagaaaaagaatatgttcaagtcgttaagtaa
caagttaataatttgatacagaaagggcaaaataaaataaaatcatattggtcaggagat
gatgtattggtggcaactaaagtttataaacagcaataggctattaaaaccctaatgaaa
tgtttaaattatccaaatacaattactgaataaaatgaaggaggatttatgggaatcgta
aatgcatttagaagaagagtaagaatgcttgtctaaactcctctatacgagaatctgatt
atgattgctgttgtaatgaatacagttattctttcactagatggtagtgttgataatcaa
tcaatactagattaatttaattaagcttttacttacatttttgcaattgacatgggatta
aaattgataggcttaggttttgccttatattgcgcagataggatgaatatttttgatggt
ttaattgttatactctcaatatttgatataatatttctatcgggatcttcaggtggcagc
tcatttagtgcttttagatctttaagaatattaagagtgtttagagttctgagagttaca
cgtcttttgcgttctttgaaatttatgaaaatattgataaaagttatttcatcaatatta
gataagctattttatattattttactgctaattttatacatttttatttatactttgatt
ggtatgtaactatatggaggttctttcttaagtgtctcaaggagtaacagaatggtcttt
gattcctttttataagccagtttttctgtatacgatttactaacaatagaaaattggaat
aatattctttatgtagcactcagaacttaagtaaatgtaggtattacctgtatctacctt
attagctgtatttttataggtaattttatcattatgaaccttgtgttagcaacaatgatt
ggagcttttaattcaagctaatttgataaggaaaaagaagagatagctaacactgtagag
attgttgaagatttagatcttggtcataccactacccttaactctactacatttatgaac
atgtccaactctcagtctagattgggttctagcactcacagcttctcagttaaaaataga
taaagaatgctcagcagcggaggttcttcttagggttattcagatgaacattcttaaaat
aatcattcttaacatagtttctctaaaaaatcgtagcaaatttaaaaagaatctttttct
cgtgagtacaaagaaaaagcaagcagcatcagcgattcacataattagagtttagataac
aaatctagtcataatttggaactctaaattgtttctgaataagaataaaacaatgataaa
aataatcaaaaaaatatgtttaaatagcaggctgttgtaaaaaaagatgaagatgatgag
aaagaagagatatttttgttttttgataatatcaaatgctaaaaatctctttacatcttt
tctatgcaaaacaaaataagaagagccttctatttcatagtcaaaaacccgctgtttgat
aatataatattagcaggtattatactcaactcagttaagttagtttctgacacatatgat
acaggttcggattcataaaaacaagcaagttaaattttagacatcatgtttactgtattc
ttttcgattgaatcctgcttaaaaatagtttcttatggatttttctttgatgaaaactca
tatcttagagataattggtcaaaactcgatttctttgttgtagttacgagtattatagat
gtatctttataaaatggaaattttgcctctctaaaaattctaagattgctcagaactctc
cgtcctttgagggttttgcaccacaataagagcatgaaattaattgtaaccactcttctt
gagtctattgttggtattttgaacatgcttcttgttattttcttagtttggttaatgttt
gccatattgggtgtaagcttaatgggtggaaagctataatattgcaattttccaaataat
ggaatcagttataatatttacaaatataactaatcttaatgtagtagagtaggaggaagc
tggtaaacttacgatttgaatttcgataatgttccagcagctttgttaaatttatttgta
atatctacttttgaaggatggcctgcatatgtttttaactacttggatggatcttctgat
ggtccagtttattttggaagtgcttacttctcaatttatatagtctttttcatattagtt
ggcagctttttctcaatagatctttttggtgcagtgctatcatttcattatgatatagca
ttacaaaaaagtaaaaataaatatctttcaagcgagtaaacacaatggatagaactttag
agattgattctttagtcgaaaccagattacaactctatctctctcccaacaaataaattt
agaaaattcatttggaacatttgcgaatcatagaagctcgaaatatttataatgatctgt
attataggtaacatagtatctatggctctaagctatgatacatctccttcttcctacgat
acaatcctgtaggatatcaatcttggtttctcaatagtttttatcactgaatgcttatta
aaattaatagcgtatgggttcaatgggtatttttataagtcatctaattagtttgatttc
tttgtggtttctgtttcagtgatagatattatttttacttattctggaaattaatttata
aaattcttatctgctggaccacaaattgctagaattttcagagtctttagagtgactcgt
ttgctgcgtcttataaaataatttgaagggttataaaagcttatgtcaactcttatttat
gctttaccatctcttactaatgcaactgctttactatttttaatttattttatctttgct
attttggcttgctatttatactctccatactaaacaggaaacagtttgaattcattttag
aatttctcaacatttcatagatcttatttgttgctatttaggatgagcactggtgaggat
tggtatttaattatgtttgatataattcaccatactaacatgtggagtgcttttttcttt
gttgtatttataattattcagtaatatattatgatgagcttatttatcttgattattatt
gaacaatttgaaaacaactatatcaatcctgacaatccaattaacgacttctagtattca
gaggaggatttcaaaaaataatgggttcaatttactagaaatagctatggaattaaaata
catgagagatttattacagatttctacttctctatattaagaccacttggttttgattac
aagtctaagctaaaagagttcgtggaataagttaagacaattaactaacaagtaagtgaa
taagatttagagctaatcactggtaaatttagaatcaaataaaagcagttagctgagaag
gagattatgaaaatgaatataagatgtgattatgatggttatatattctataatgaattg
ctttactattttttcaaacactcactttatgatagtgtgtttggcagaatagacaatgct
tctactaaatccgaatatgaaaaatgtatcaaggctgaagagattctatacaaagaagaa
cacattacacgtagaaaactcagaatattaaaaaagaaacaagctgccttgaccaaataa
aaatttatctccagcagataaaaagaagtaaatcctatggttagaagattatttgttggc
atgtgctttaaaagctggttaaagtatagttagaaaatttaaaacaatattatgcaagac
tatgatgatatttcgagctaaacagattctgatgaggagtatgattaacttcaggttgac
cctgaagatttataaaatgctttagctattgataaattctacacttcacaggataaagag
gagaatatcatagaagttttaaaaaatagaagatttattatacctcgtcttcacacaata
aaattgagaaagtaagattaaaaggaataaatagctgatggttttttcaatggaaaatat
tttgaatttccaaacccagatgaaatttataaagcagagttagaaaatgaataaaatatt
aatgaatttgaagaaaggattaatgagtaataaaaatagttgtaaataataaaaaataat
gaataaaataataaataaatgctctcttcagttaactcaaactatcaagaaaggacaaaa
tcaatccaaagaagttaactaaataattaaagaaataacacacttaaactttctcatgct
tttaatattccaagcaaacgcacttcaattgatgtaaacaatctaaatttaattcatagc
aacaatttgttatcaatctagaatgtataatctaacaaccagctagtgcctaaagactaa
actaaacttaagctatctcttgttgaatcttcaaattctcttggaatgagtgtaagaaaa
gaatccattgtaaaaaaagactcccataatgtttcaactcctaaatctcaattaaatcta
agttaagtaaaaaaattaaccctctaaaaaaataactctaattctccaagactttaagtg
cctcttgaaaataatcgtcagagaaaggacagtaagtcgattttctcaatgaccccatag
aatagagctaatgaaaatgagaacatagaagataaacttaattctcagcatttgatgcat
ctccaagcaactcctatcacatttacttaatttgtcaactcaaagaatttcatgagcagt
ccagaaaatgaatctgatgatgaacataaataataaattagattagatttaacaaaataa
taatccagctaaataaaatctcctaaaaaagaaatcagcagatttggcgagtcttcttca
attataaattaattaaaataagattttaatataaatggtcatgaaaaaaataatgaaagt
aatgataaacactcgtcaataatgaacatgccaaatctttaataaaaatcatattctcag
tagtctgataagcatcaagcaaaaattcctattgataactaggagcataaaaagccaaat
ttaaataaaaatattccttaaattagaataaattttgaagaagattga

DBGET integrated database retrieval system