KEGG   Tetrahymena thermophila: TTHERM_00684700Help
Entry
TTHERM_00684700   CDS       T01020                                 

Definition
(RefSeq) calcineurin regulatory subunit B, putative
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tet  Tetrahymena thermophila
Brite
Protein phosphatases and associated proteins [BR:tet01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TTHERM_00684700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 7830702
NCBI-ProteinID: XP_001025171
TGD: TTHERM_00684700
UniProt: I7M453
AA seq 170 aa AA seqDB search
MGNTVGLTPLEVQQISQCTNFDEKDVRKIFRKYQKLDKVSKGNVNYFDMQRLPEISQNPL
GERVAKSLSHSQINPSVDFTTFISNLNTFNSNNQEAKIKFYFKVYDTDEDGVISKQDVEN
VFSLLVNNEIKKFQLKDIIDTLFSQYKLKNENYFDYQEFKSLVLQMQEQM
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggggaatactgtaggattaacacctctagaagtttaataaatatcttaatgcactaat
tttgatgaaaaagatgtgagaaagatttttaggaaatattaaaagctagataaagttagt
aaaggaaatgttaactactttgatatgtagagattaccagaaataagctagaacccacta
ggagagagagtagcaaaatcattgtcacattcttaaataaacccatcagtagatttcaca
acatttatatcaaacttaaatactttcaatagcaacaactaagaagcaaagataaaattt
tactttaaagtgtatgatactgatgaagatggagtaataagcaaacaagatgtagaaaat
gtatttagccttcttgtaaataatgaaataaaaaagttttagctcaaagatataattgac
actctattttcttaatacaagcttaaaaatgaaaactattttgattattaagaatttaaa
agcctcgtattacaaatgtaagaataaatgtga

DBGET integrated database retrieval system