KEGG   Tetrahymena thermophila: TTHERM_00684700Help
Entry
TTHERM_00684700   CDS       T01020                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNTVGLTPLEVQQISQCTNFDEKDVRKIFRKYQKLDKVSKGNVNYFDMQRLPEISQNPL
GERVAKSLSHSQINPSVDFTTFISNLNTFNSNNQEAKIKFYFKVYDTDEDGVISKQDVEN
VFSLLVNNEIKKFQLKDIIDTLFSQYKLKNENYFDYQEFKSLVLQMQEQM
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggggaatactgtaggattaacacctctagaagtttaataaatatcttaatgcactaat
tttgatgaaaaagatgtgagaaagatttttaggaaatattaaaagctagataaagttagt
aaaggaaatgttaactactttgatatgtagagattaccagaaataagctagaacccacta
ggagagagagtagcaaaatcattgtcacattcttaaataaacccatcagtagatttcaca
acatttatatcaaacttaaatactttcaatagcaacaactaagaagcaaagataaaattt
tactttaaagtgtatgatactgatgaagatggagtaataagcaaacaagatgtagaaaat
gtatttagccttcttgtaaataatgaaataaaaaagttttagctcaaagatataattgac
actctattttcttaatacaagcttaaaaatgaaaactattttgattattaagaatttaaa
agcctcgtattacaaatgtaagaataaatgtga

DBGET integrated database retrieval system