KEGG   Tetrahymena thermophila: TTHERM_00691880Help
Entry
TTHERM_00691880   CDS       T01020                                 

Definition
(RefSeq) tetratricopeptide repeat protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
tet  Tetrahymena thermophila
Pathway
tet04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    TTHERM_00691880
Protein phosphatases and associated proteins [BR:tet01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TTHERM_00691880
Ubiquitin system [BR:tet04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     TTHERM_00691880
Chromosome and associated proteins [BR:tet03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    TTHERM_00691880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_8 TPR_12 TPR_16 ANAPC3 TPR_14 TPR_7 TPR_19 TPR_11 TPR_9 TPR_15 Ribonuclease_T2 MAS20
Motif
Other DBs
NCBI-GeneID: 7830828
NCBI-ProteinID: XP_001032153
TGD: TTHERM_00691880
UniProt: I7LZP8
AA seq 840 aa AA seqDB search
MEEDGQNTNQTLIRQLIDSIEDNLANHLPSNAVFLAERLLAEQDTEETRGILAECYMAEN
KHYKVYDILKLCKSEMNRYRFALVCLKLNKNQDGEKALLMENYNPQDQNMQSKHRSQMLP
DYVPNGCYGFYLLGLIYEGQQKFQEAKNYFVKALELNPTLWVAYEKICKIGDQEILPYKI
FCETKYKQYINSKKAKGLYSFNPQVNFLRNFKESAGFYNSTDETEDGNSLANQVANKQRI
PNQAKDQGLQRNPAQQAIKPGTSNISTIGQVTAGRNDSNSRNNSAKRKKSGKLDNGVGLL
SSIPSQPSSGSSNIQGGQNSQLGVGSQQFPAASSANQYIPGQMGNSSVLQFDSTSATLLG
LQQKMSSSVNNTSTSQQQQQQILSQGLNLGMNNPNQFISANSQFQNLQNTVNSPYIESRY
GGSQDYYQFQKPTAAMQSTAYNIYAQQGGVNKNLQTPQINMLLSNQMNQHQLQSNIQPFF
GAPGFQQQLSANDFSQSVSSSATPIRDICTLLRRFGEAFYHMSLYLCKEAIDYFFNLPKN
HQQTGWVLTHIGRCYMEIVKYSEAEKYYTEALRIEPYRLEGIEYYSSCLWHLKKQVELCY
LAHQALDKSLFAPETWIAVGNCFSLQKEHENALKFFQRAIQLNQQSAYAHALCGHEFVYN
EDFARARKSFQQALNLDLRNYNAWWGLGNIFYKQEKYNRAAEHFQNAIKINQKNPVLYSF
MGMTLAADRNYSSALQYFEQSEKLDPKNGLNKFQKANTLVKLEKYEAALKELQELNLMMP
KEAPIPMLMGKVYKKLNKTDLALKYFTDALDLENKDTQRIKALIESLHQENQDFGEDLEI
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagacggttaaaatacaaactagactttaattcgctaacttatcgattctatt
gaagataatttagccaatcatctgccttcaaatgctgtgtttttagctgagaggttactc
gctgaataagatacagaagaaacacgcggtattttagcagagtgttacatggctgaaaac
aagcattataaagtttatgatatcctcaagctttgcaaatcagaaatgaatagatacaga
tttgctttagtttgtcttaagcttaacaaaaatcaagacggagaaaaagctttgttaatg
gaaaattacaacccttaggattaaaatatgtaatctaagcacaggtcttaaatgctacca
gactacgttcctaacggttgctatggattctacttacttggtttaatctatgaaggataa
tagaagttttaggaagcaaaaaattattttgtgaaggcgttagaattaaatccaacatta
tgggtagcatatgaaaagatttgtaagattggtgattaagaaatcctaccttacaagatt
ttctgtgagacaaaatataaataatatatcaattcaaagaaggctaaaggcttgtatagc
ttcaatccataagttaactttttaagaaacttcaaagaatctgctggtttttataattca
actgatgagactgaagatggaaatagtttagcaaatcaagtggcaaataaataaagaata
cctaatcaagctaaagatcagggtctttaaagaaatccagctcagtaagcaatcaaacct
ggaacatcaaatatttctactataggataagtgactgcaggaagaaacgatagtaattca
agaaataatagtgcaaaaaggaaaaaatcaggaaagttagataatggtgtaggcctttta
agctctataccatcacaaccatctagtggtagcagtaacatttaaggagggtaaaatagt
taattaggcgtaggttcttaacaatttcctgctgcctcttctgctaactaatacattcct
ggttagatgggtaattcaagtgttttgcaatttgattccacatcagctactttattaggt
ttataataaaagatgtcttcttctgttaataatacaagtacatcacagcaatagcaacaa
caaatattatcttaaggacttaatttgggcatgaataatcctaatcaatttatatctgca
aatagctaattctaaaatctttaaaatactgttaattcgccttatattgaatctcgctat
ggtggtagttaagattattattaattttaaaaacctactgctgctatgtagtctactgct
tataatatttatgcataataaggaggtgttaataaaaatttacaaactccatagataaat
atgttactaagcaattaaatgaattagcactagctttaaagtaacatttagcctttcttt
ggagctcctggattttagtaataattgagtgcaaatgatttttcttaatctgtttcctct
tcagcaactcctattagagatatttgcactcttcttagaagatttggtgaagccttctat
catatgtcactttacttgtgcaaagaagctattgattatttctttaaccttcctaaaaat
cattaacaaacaggttgggttcttactcatattggtagatgctatatggaaattgttaag
tacagtgaagctgaaaagtattatactgaagctctaagaattgagccttacagactagaa
ggaattgagtattattctagttgcttatggcacttgaagaagcaagtagaactctgttat
cttgcccattaggctttagataagtctttatttgctccagaaacatggattgcagttgga
aactgctttagtttataaaaggagcatgaaaatgcattaaaattcttctaaagagcaatt
taattgaatcaacaatcagcctatgctcatgctctttgtggtcatgaatttgtgtacaac
gaagactttgctcgtgctagaaaatcattccaacaagctcttaatcttgatctaagaaat
tacaatgcttggtggggacttggtaatatcttttataaataagaaaaatacaatcgtgca
gctgaacatttccaaaatgcaatcaaaattaattaaaaaaatccagtgctctattcattt
atgggtatgacattagctgcagacagaaactatagctcagccctttaatattttgaataa
tcagaaaagctagaccctaaaaatggattaaataaattctaaaaagccaacactttagta
aaattagagaaatacgaagctgccttaaaagaattataagaattaaatttgatgatgcca
aaagaagcccctatacctatgctaatgggaaaggtttataaaaagcttaataaaacagat
ctggctttgaaatactttacagatgctctagatttagaaaataaagatacccaaagaata
aaagctttaatagaatctctgcatcaagaaaattaagattttggagaagacctagaaatt
tga

DBGET integrated database retrieval system