KEGG   Tetrahymena thermophila: TTHERM_00757780Help
Entry
TTHERM_00757780   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein (EC:3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tet  Tetrahymena thermophila
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tet00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TTHERM_00757780
Enzymes [BR:tet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TTHERM_00757780
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TTHERM_00757780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 1170 aa AA seqDB search
MGICGIKSQQIFATEDLRKSSLRKNSNKQFVENVKSPLKRENKLNIDYCQIPNDIHQSKQ
RYNELTDQDPLGLVGISNLGNTCFINSALQCLLNVQPLMDYFLSDLHNQEVNTNNPLGSK
GKVTYAFADLVNMIWCQNNKYIVPKVFLNTIQQFSAIFGDGSQQDSQEFLIFLLDLLHEV
KKQRLFKLIVSATSIFLYKKDLNRVKKKPAIEDKDYQSDQYETYAAESWKNYLLRNKSIV
VDLFQGQLKSTLKCLVCETVSHKFDTFMYLSVPIPQQDKNQSKGIISIEDCIEEFTKEEK
LDKSEWWLCTSCKKRTPSTKKIDLWKTPNILIIHLKRFSFTKENRGKINKFIDFKITQFD
LSQKVSGKEKMRPIYDLFSVCFKLDNTQANVYLIGTISKNKVLKLLYIKITIKNILTLQF
VKQNHSGNLGGGHYTAYAKNRDTQDWYLFDDSKVYYVKNPYKEIISQKAYVLFYSKTSVD
KFQRQTISRPEFWPHFINNSNSIINQNSLNDGTQNQKKSVSALSIQKQDSRVNQQNILSQ
NNISSVKSTPQQSNGKQFQNQISLFDDENRQQNLEKSNQMTSRKQNNNNGNMTPIYEQKP
NEFQENLDRSPIIKGNKQGDSFMNDSDFMPSVIAYNYTKQNFNGQRPEKLELIKKDQNLN
SFSIKPYPLNEDEYNNQNEQSQQTNQNEMQSQRSFDQNENKNFKFKVKRISVNKRQNNSD
SKDKLIDQDKSLAQKDRLPPLIQFRNNHEFEENSSFLNQESQTNQSNQIEDDKKRPSFQN
NTNNNHDSTFNNSYNNTNNNTNINYINNIRYQQNRENSPNLSFYHNSSMGEIPSLGSKQY
KTKNSQHTATYKGGNDQHLNEYNQTFEVNQKMRNGKQNHINDYQDIFAKPNQNGNYLNSN
LPRIIQDEYNDQIKQNGTTLNTQISIHERQSLNGQKLERFSDRKSRNNLRNNEINYLVYE
NRQGSQSNFMDIYLEKNQDQQNQLMNNPQINRQQIQTETQRHLSYDQAGRRNKYNTYTPE
KHKYFAQNESKEAKANTSVAVQMLIDKKLTYKPPLNNNRINSNENSSNQLIITDSSSKNK
IGNQSQIDPRQILASSFNSNQNSSSNYESSPVRAKRTSNIASSNSNYKYNNSIQQNNSNN
FVNNNNNNQISNHYLNNMNSSPQKNYIKNH
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgggcatctgcggcattaaaagttaataaatatttgcaactgaagacttgaggaaatca
tcattgaggaaaaatagcaataaacagtttgtagaaaatgtaaaatcacctttgaagaga
gaaaataagctgaatatagattattgtcagatcccaaacgatatacatcagagtaagcag
agatataatgaattaacagactaagatcctctgggtttggtcggtatatcaaatttagga
aatacttgttttatcaattcagctctttaatgtcttctgaatgtttaacccctaatggat
tatttcttgagtgatttacataattaagaggttaatacaaataatccacttggatctaaa
ggtaaagtaacttatgcttttgctgatttagtgaacatgatatggtgtcaaaacaataaa
tacattgtgccaaaagtatttttaaatactatatagtagttttctgcaatatttggtgat
ggttcacaataagattctcaagaatttttgatatttctacttgatttactgcacgaagta
aagaaatagagattatttaaattaattgtgtcagctacaagtatttttctttataaaaag
gatttaaatagagtcaaaaagaaacctgcaattgaagataaagattattaaagtgatcaa
tatgaaacatatgcagctgaatcctggaaaaattatcttcttagaaataaatctatagta
gtagatctctttcaaggacaacttaaatcaacactaaagtgtttagtttgtgaaactgtt
tcccacaaattcgatacttttatgtatttgagtgttccaattccataacaagacaagaat
taatccaaaggcataatatctattgaagattgcattgaggaattcacaaaagaagaaaag
cttgataaaagtgaatggtggctttgcacttcatgtaaaaaaagaacgccctcaacaaaa
aaaatagatttatggaagactcctaacattctgattatccatttaaaaagattttctttc
acaaaagaaaacagaggaaaaatcaacaaatttatagatttcaaaattactcaatttgat
ctcagctaaaaagtttcaggaaaagaaaaaatgagaccaatttatgatcttttctcagtt
tgtttcaagctagataatacctaagctaatgtatatcttattggtactatatcaaaaaat
aaagttcttaaactactttatatcaaaattactatcaaaaacattcttacactttaattt
gttaaatagaaccattctggaaatttaggaggaggacattatacagcttatgcaaagaat
agagatactcaagattggtatttgtttgatgattctaaagtttattacgtgaagaatcca
tataaagaaataatttcatagaaagcttacgttttattttattcaaagacaagtgttgat
aagttttagagacaaactatttcaagaccagaattttggcctcactttataaataatagt
aattctattatcaattaaaattctttgaatgatggaacataaaattaaaaaaaatctgtt
tctgcactcagcattcagaaataagactcaagagtaaactaacaaaatattcttagtcaa
aacaatatctcttcagttaaatcaactccttaataaagtaatggcaaataatttcagaat
taaataagcttatttgatgacgaaaacagacaacaaaatttagaaaaatcaaattaaatg
acaagcagaaaacaaaataacaacaatggaaatatgactccaatttatgaataaaaaccg
aatgagttctaagaaaatttagatcgcagccctatcatcaaaggaaataaatagggcgac
agttttatgaatgatagcgattttatgcccagtgtaatcgcttacaattacactaaataa
aatttcaatggttagagaccagaaaagcttgaattaataaaaaaagattaaaatttgaat
agtttttcaattaaaccttatcctttaaacgaagatgagtacaataactaaaacgaacaa
tctcaacaaacaaattaaaatgaaatgcaatcttaaagaagctttgattaaaatgaaaac
aaaaattttaaattcaaagtgaaacgaatttcagttaataaaagataaaataattctgac
tcaaaagataaactaattgattaagataagtctttagctcaaaaagaccgtctacctcca
ttaatttaatttagaaataatcacgaatttgaagaaaactcttcttttcttaactaagag
tcataaacaaactaatcaaactaaatcgaagacgacaagaaaagaccctctttttaaaac
aatactaacaataatcatgatagcacttttaataattcttataataacactaataataat
actaatataaattatattaataatataagatactaacaaaacagagaaaattctccaaat
ttatcattctatcacaattcttccatgggagaaataccttctttaggttcaaaacaatac
aaaactaaaaatagtcaacacactgctacgtacaagggtggaaatgatcaacacttaaat
gaatacaactaaacatttgaagttaattaaaagatgagaaatggtaagtaaaatcatatt
aatgactatcaagatatatttgctaaacccaattagaacggtaactatttaaactcaaac
ctaccaagaataatataagatgaatataatgactaaattaagcaaaatggcacaacttta
aacactcaaataagtattcatgaaagacaaagtttaaatggttaaaaattagaaagattt
agtgataggaagagtaggaataatttgagaaacaatgaaataaactaccttgtttacgaa
aacagatagggttctcaatctaatttcatggatatctacttagaaaagaattaagattaa
taaaattaattaatgaataatccccaaataaacagatagtaaatctaaacagaaactcag
aggcatctcagctatgactaagcaggcagaagaaacaaatacaatacatatacacctgaa
aaacacaaatattttgcataaaatgaatcaaaagaagctaaagctaatacttctgtagct
gtataaatgttaatcgacaaaaaactcacatacaaacctccacttaacaataacaggatt
aattcaaatgaaaactcttctaatcaattaattataacagattcctcttccaaaaataaa
attgggaattaatcttaaatagatccaagataaatcttagcaagcagttttaattcaaat
tagaattccagctctaattatgaatctagcccagttagagcaaaaagaacatcgaatata
gcatctagcaattcaaactataaatataacaactctatttaacaaaataattcaaataat
ttcgtaaacaataataataacaactaaatttcaaaccactacctcaataatatgaatagc
tctccctaaaaaaattatattaaaaatcattga

DBGET integrated database retrieval system