KEGG   Tetrahymena thermophila: TTHERM_00773580Help
Entry
TTHERM_00773580   CDS       T01020                                 

Definition
Cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
tet  Tetrahymena thermophila
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TTHERM_00773580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 114 aa AA seqDB search
MPPKKGPKEPEVNVPEGDASAGRDIFDAQCSACHAIEGDSTAAPVLGGVVGRKAGQEKFA
YSKSMKNSGITWSDKHLFVFLKNPSKHVPGTKMAFAGLAADKDRADLIAYLKSV
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaaaaaggacccaaggaacccgaagttaatgtccctgaaggtgacgcttct
gctggtagagatattttcgatgcccaatgctctgcttgccacgctattgaaggtgactct
actgccgctcccgttctcggtggtgtcgtcggaagaaaggccggttaagaaaagttcgct
tactccaagtccatgaagaactctggtatcacttggagcgacaagcaccttttcgttttc
ctcaagaatccctctaagcacgttcccggtactaagatggcttttgccggtcttgctgct
gataaggacagagctgatcttattgcttacctcaagtctgtttga

DBGET integrated database retrieval system