KEGG   Tetrahymena thermophila: TTHERM_00787140Help
Entry
TTHERM_00787140   CDS       T01020                                 

Definition
FAD dependent oxidoreductase family protein (EC:1.4.3.3)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 373 aa AA seqDB search
MSHQELPKVDNKRVIRLVPPVLTQDRIVGFKAGLRPFRKGGVRLEEEKIGNKVFFHNYGH
GAGGVSVGYGYSTLAFNKFASKYHDAHDAKKVAIVGSGYIGLFTSLLLRENGYDVTIYAD
KTIKTQGFSNPDSDDKSLPTTSQIAGGFWVPYGYDFNCSAEARETHELACRLSFAFYEKA
LHHKNIRGVSYKKTVHVDSIDYIKRSVPNGLIKDYEDVKVTFNGVDLIDAHYFTTLLIDG
DLFLNDLKQECIRKGVQFVDRHFNTVNDMLSLEERFIFNCTGCSAGKLFNDPNVYPLKGQ
LVAFKPTPGVDYFFRTQIENGAFVSFYPQQDVLPVGLVEQKDDWNPRPTVETCNRIAQNA
IKYFEKYNTAPKL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccaagaactccctaaagttgataataagcgcgttattagattagttcctcca
gtcttgacacaagatagaatagttggttttaaggcaggcttaagaccattccgtaaaggt
ggtgtccgtcttgaagaagaaaaaattggtaacaaggttttcttccacaattatggccac
ggagctggtggtgtctctgtaggatatggatacagtactttggctttcaacaaatttgca
agcaaatatcatgacgctcatgatgctaagaaggttgctatcgttggtagtggttatatt
ggcttatttacctctcttcttcttcgtgaaaacggttatgatgtaactatatatgctgac
aaaactattaagacataaggattttcaaatcctgattcagatgataaatctcttcccaca
acctctcaaatagctggaggtttctgggtcccttatggttatgatttcaattgctcagct
gaagctagagaaacccatgaacttgcttgcagattaagttttgccttctatgaaaaggct
ctacatcataagaacattagaggagtttcttacaagaagactgttcatgttgattcaatt
gattacattaaaagaagtgttcctaatggtcttattaaagattacgaagatgttaaagtt
accttcaatggagtagatttgattgatgcccattactttacaactcttcttatcgatgga
gatctcttccttaatgatttgaaataggaatgtatcagaaaaggagtttaattcgtcgat
agacatttcaatactgttaatgatatgctttctcttgaagaaaggttcattttcaattgc
acaggctgctctgctggtaaactcttcaatgaccctaatgtttatcctcttaaaggttag
cttgttgctttcaagcccactcctggagttgactatttcttccgtacataaatagaaaac
ggagcttttgtctcattctatccctaataagatgttttaccagttggtttagttgaataa
aaagatgactggaatcccagaccaactgttgaaacctgcaacagaatagctcaaaatgca
attaaatatttcgaaaaatacaatactgctccaaagctttga

DBGET integrated database retrieval system