KEGG   Tetrahymena thermophila: TTHERM_00790780Help
Entry
TTHERM_00790780   CDS       T01020                                 

Definition
Glycosyl transferase family, helical bundle domain containing protein (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tet  Tetrahymena thermophila
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TTHERM_00790780
Enzymes [BR:tet01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TTHERM_00790780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 488 aa AA seqDB search
MSTFNYKDLIRDKKEGKQLTKEQIFAWVEGVTNKTMPEYQLSALLMAIYFKGMTIEERGY
LTQAMASSGKRMNYRDIPGRKVDKHSSGGIGDKTSIILVPLMMELGVKTPMVSGRGLGHT
GGTTDKLEAIPGFLVGISFEKMKEMMQSIGCFMGTQTADIAPADKVIYGMRDVTETVDEI
SLITASILSKKFTEDLDALVMDVKCGPSAFMRTIEKATELADSIKRTCESTGTQCKACIT
RMDFPLGEHIGNANEIYECIIAFDTKSEYCNSVRRLQFCKNTPGLVKFENGVQSAVDVLV
IITFVLALQMYLVSGLESDELKGFEAVKKAWLSGNLHKHFDQLCALQGGSVDKFLAHYKL
IQDQLDKPEQSGKVITITAPKDGKLVKVDGVAIGNLMVDLNAGRKVFGEPINHDVSMQWY
PYPNQQIKKGDVICKIYHPDFVKKNDHTFTFKADQHFCSTVTKRVHDTLIYSEDPNYTYS
EPLVYNVL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttttaactacaaggatttgattagagacaagaaggaaggcaagcaattgaca
aaggaatagatctttgcttgggttgaaggagtcacaaacaagaccatgcctgaatactaa
ttaagtgccttattaatggcaatctacttcaagggtatgactattgaagagagaggttat
ttgactcaagctatggcttcctctggtaagagaatgaactacagagacattcccggcaga
aaagttgacaagcattcatctggtggtattggtgataagacttctatcattcttgttccc
ttaatgatggaattaggcgttaaaactcccatggttagtggtagaggtttaggtcacact
ggtggtactactgacaaattagaagctattccaggattcttggttggaatttctttcgaa
aagatgaaagaaatgatgtaaagcatcggttgcttcatgggtactcaaactgccgatatt
gctcctgctgataaggtcatttacggaatgagagacgttactgaaactgtagacgaaatc
tctctcattactgcttccattctctccaagaaattcactgaagacctcgatgctttggtt
atggatgttaaatgtggtccttctgcattcatgagaactattgaaaaggctactgaattg
gctgatagtattaagagaacatgcgaatctactggaactcaatgcaaagcttgcatcact
agaatggatttccccttgggtgaacacattggtaatgctaatgaaatttacgaatgcatt
attgcttttgacactaagagcgaatactgcaactcagttagaagactctaattctgcaag
aacactcctggtcttgttaaatttgaaaacggagttcaaagtgctgttgatgtcttagtt
atcattacctttgtccttgctctccaaatgtacttagttagcggacttgaaagtgatgaa
ttaaagggctttgaagctgttaaaaaggcctggttaagtggaaatttgcacaagcatttt
gattaactttgcgctttacaaggtggttcagttgataaattcttagctcactataaactc
atctaagattaactcgataagcctgaataaagtggtaaagttatcactatcactgctcct
aaagacggtaaattagtaaaagttgatggtgttgcaattggtaatttgatggttgactta
aatgctggtagaaaggtctttggtgaacctatcaaccatgatgtatctatgtaatggtat
ccctaccccaactaacaaataaagaaaggtgacgttatctgtaaaatctatcaccctgat
ttcgtaaagaagaacgaccacacatttactttcaaggctgatcaacatttctgctcaacc
gtaactaagagagttcatgatactttaatttattctgaagatcctaactacacttatagc
gaacctttagtttataacgttttgtga

DBGET integrated database retrieval system