KEGG   Tetrahymena thermophila: TTHERM_00878160Help
Entry
TTHERM_00878160   CDS       T01020                                 

Definition
malate synthase A family protein (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tet  Tetrahymena thermophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tet01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tet00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tet00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 537 aa AA seqDB search
MSTSLKGITILEENQYTREVLTPECLQFVATLHRQFNSTRKALLRARKERAQLVDRGMAL
TYPPETKHIREGDWKVAPPPKDVERRWIELTGPPNPKLTINAMNSGADVFMADFEDALAP
TWVNQVSGQKTLILANKKALQFNDKNKEYKLNPDSYTVLFVRPRGWHLEETHLVIDGEPC
SASLFDFAVYFFHNVRLRLANGCGGIYYYLPKIEAYRECRLWNDVFVKAQQLFNLPIGTI
RCTVLIETLGGGLEMEEFLYELRDHIVGLNAGRWDYIFSAIKMLKNNKAAILPDRSQVTM
TVPFMRAYTNRLIQVCHKRGAHAIGGMSAFIPAKDKAQNEFAFNKITEDKTREVNDGFDG
SWVAHPGMVKHARDIFEKYLKGKANQKQVLREDIKVTADDITNLTVEKPITENGVRQNIN
VAIQYTYYWITGTGAVGLHNLMEDAATAEISRSQLWQWIRYRCRTDSGVLINEALYRAVR
DEEVTKLRSTLTNEVALQRAVDVIDKVVLDETFYDFLTVEAYPILNNLNVSHVTPRL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactagcttgaagggtatcaccatcttagaagaaaactaatacactcgtgaggtt
ttgactcctgaatgtttacaattcgttgccaccttacatagacaattcaactctactaga
aaggccctcctcagagccaggaaagaaagagcttaactcgtcgatagaggtatggccctc
acctatcctcctgaaactaagcacattcgtgaaggagactggaaggttgctcctcctccc
aaggatgttgagagaagatggatcgaacttactggcccacccaatcctaagctcaccatc
aacgctatgaactcaggagctgacgttttcatggctgatttcgaagatgcacttgctcct
acatgggtaaattaagtcagtggacaaaagactcttatcttagccaataagaaagctctt
tagttcaatgacaaaaataaggaatacaagttaaatcctgattcttacactgttcttttt
gttagacctagaggctggcatttggaagaaactcacttagtcatcgacggagaaccatgc
tctgcatcattattcgactttgcagtttatttcttccacaatgttagacttagacttgct
aatggttgtggtggaatctattactaccttcctaagattgaagcctacagagaatgcaga
ctttggaatgatgtcttcgttaaggcctaataactattcaacttacctattggcacaatt
agatgcacagtcttgatcgaaactttgggtggtggtcttgaaatggaagaattcctttat
gaattaagagatcacattgttggattaaatgctggtagatgggactacatcttctctgct
attaagatgcttaagaacaacaaagctgctatcctccctgacagatcccaagtcactatg
accgttcctttcatgagagcatacacaaacagactcattcaagtatgccacaagagagga
gctcatgctattggtggtatgagtgctttcattcctgctaaggataaagcttagaatgaa
ttcgcttttaacaagatcactgaagacaagactagagaagttaacgacggttttgatgga
tcttgggttgcccatccaggaatggttaagcacgctagagatatattcgaaaaatattta
aaaggaaaggctaaccaaaagtaggtattacgtgaagatattaaagtaactgcagatgat
atcaccaatttaactgttgaaaaacctattactgaaaatggtgttagataaaatatcaac
gtagctatttaatacacttattactggattactggtactggagcagttggtctccataat
ttgatggaagatgctgctactgctgaaatttcccgttcctaactctggtagtggattaga
tatagatgcagaactgactctggagtcttaataaatgaagccctttacagagctgtaaga
gatgaagaagtaactaaattaagatcaactttaaccaacgaagtggctttacaaagagct
gttgatgttattgacaaagtagtccttgatgaaactttctacgatttcttaacagttgaa
gcatatccaattttaaataacttaaatgtctctcatgttactcctagactttga

DBGET integrated database retrieval system