KEGG   Tetrahymena thermophila: TTHERM_00878160Help
Entry
TTHERM_00878160   CDS       T01020                                 

Definition
malate synthase A family protein (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tet  Tetrahymena thermophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHERM_00878160
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTHERM_00878160
   00630 Glyoxylate and dicarboxylate metabolism
    TTHERM_00878160
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TTHERM_00878160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 537 aa AA seqDB search
MSTSLKGITILEENQYTREVLTPECLQFVATLHRQFNSTRKALLRARKERAQLVDRGMAL
TYPPETKHIREGDWKVAPPPKDVERRWIELTGPPNPKLTINAMNSGADVFMADFEDALAP
TWVNQVSGQKTLILANKKALQFNDKNKEYKLNPDSYTVLFVRPRGWHLEETHLVIDGEPC
SASLFDFAVYFFHNVRLRLANGCGGIYYYLPKIEAYRECRLWNDVFVKAQQLFNLPIGTI
RCTVLIETLGGGLEMEEFLYELRDHIVGLNAGRWDYIFSAIKMLKNNKAAILPDRSQVTM
TVPFMRAYTNRLIQVCHKRGAHAIGGMSAFIPAKDKAQNEFAFNKITEDKTREVNDGFDG
SWVAHPGMVKHARDIFEKYLKGKANQKQVLREDIKVTADDITNLTVEKPITENGVRQNIN
VAIQYTYYWITGTGAVGLHNLMEDAATAEISRSQLWQWIRYRCRTDSGVLINEALYRAVR
DEEVTKLRSTLTNEVALQRAVDVIDKVVLDETFYDFLTVEAYPILNNLNVSHVTPRL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactagcttgaagggtatcaccatcttagaagaaaactaatacactcgtgaggtt
ttgactcctgaatgtttacaattcgttgccaccttacatagacaattcaactctactaga
aaggccctcctcagagccaggaaagaaagagcttaactcgtcgatagaggtatggccctc
acctatcctcctgaaactaagcacattcgtgaaggagactggaaggttgctcctcctccc
aaggatgttgagagaagatggatcgaacttactggcccacccaatcctaagctcaccatc
aacgctatgaactcaggagctgacgttttcatggctgatttcgaagatgcacttgctcct
acatgggtaaattaagtcagtggacaaaagactcttatcttagccaataagaaagctctt
tagttcaatgacaaaaataaggaatacaagttaaatcctgattcttacactgttcttttt
gttagacctagaggctggcatttggaagaaactcacttagtcatcgacggagaaccatgc
tctgcatcattattcgactttgcagtttatttcttccacaatgttagacttagacttgct
aatggttgtggtggaatctattactaccttcctaagattgaagcctacagagaatgcaga
ctttggaatgatgtcttcgttaaggcctaataactattcaacttacctattggcacaatt
agatgcacagtcttgatcgaaactttgggtggtggtcttgaaatggaagaattcctttat
gaattaagagatcacattgttggattaaatgctggtagatgggactacatcttctctgct
attaagatgcttaagaacaacaaagctgctatcctccctgacagatcccaagtcactatg
accgttcctttcatgagagcatacacaaacagactcattcaagtatgccacaagagagga
gctcatgctattggtggtatgagtgctttcattcctgctaaggataaagcttagaatgaa
ttcgcttttaacaagatcactgaagacaagactagagaagttaacgacggttttgatgga
tcttgggttgcccatccaggaatggttaagcacgctagagatatattcgaaaaatattta
aaaggaaaggctaaccaaaagtaggtattacgtgaagatattaaagtaactgcagatgat
atcaccaatttaactgttgaaaaacctattactgaaaatggtgttagataaaatatcaac
gtagctatttaatacacttattactggattactggtactggagcagttggtctccataat
ttgatggaagatgctgctactgctgaaatttcccgttcctaactctggtagtggattaga
tatagatgcagaactgactctggagtcttaataaatgaagccctttacagagctgtaaga
gatgaagaagtaactaaattaagatcaactttaaccaacgaagtggctttacaaagagct
gttgatgttattgacaaagtagtccttgatgaaactttctacgatttcttaacagttgaa
gcatatccaattttaaataacttaaatgtctctcatgttactcctagactttga

DBGET integrated database retrieval system