KEGG   Tetrahymena thermophila: TTHERM_00895660Help
Entry
TTHERM_00895660   CDS       T01020                                 

Definition
Glutathione peroxidase family protein (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tet  Tetrahymena thermophila
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TTHERM_00895660
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TTHERM_00895660
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TTHERM_00895660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 176 aa AA seqDB search
MINGTEQIQSNTSSLYELSAIDINGQNVSLKNFNNKKAIIVVNVACKCGLTSGHYTQLVE
LYKQYKSQGLEVLAFPCNQFGEQEPWAESEILSYTQKTFNVDFPLFSKIDVNGENTHPVY
KYLRRNSELFQNNSATKIPWNFAKFLIDGKTGKVISYFSPKVNPNEMEQQIKQLLQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacggtactgaataaatttaaagcaatacatctagcttatacgagctttctgct
atagacatcaatggttaaaacgtctcattgaagaactttaacaataaaaaggctattatt
gttgtaaatgtagcttgtaaatgtggtcttacttctggtcactatacttagcttgttgaa
ttgtataaatagtataaatcttaaggattagaagtcttagctttcccctgtaattaattt
ggtgaataagaaccttgggctgaatctgaaattctttcatacactcaaaagacctttaat
gttgacttcccacttttctcaaagatcgatgtgaatggtgaaaacactcatcctgtttac
aaatatttaagaagaaactcagaactattttagaacaattctgcaactaagatcccatgg
aattttgcaaaattcttgattgatggaaagactggcaaagttatttcttacttcagtcct
aaggttaatccaaacgaaatggagcaataaattaaataacttttataatga

DBGET integrated database retrieval system