KEGG   Tetrahymena thermophila: TTHERM_00895800Help
Entry
TTHERM_00895800   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein (EC:3.1.2.15)
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TTHERM_00895800
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TTHERM_00895800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 2585 aa AA seqDB search
MSSVQQLNQSQTPDKKVQQVNPILEDLQRYLAELKNYSLQKFCTVNSYIDAMDSRNQWCV
GKIISIDQKGMMDIRFDGWSDKYIECFYCSKMLLQSKISKLSISIGKQQKGILAVWVQKY
TFPYTGAIKSTTRDDLTIEKMREESNAQIEELSLLENDDFNIQNVNTFIQNFRGRYFFLA
DYILSINKSFQDNDIQQFIEFFQIYIKVFIKYIKLLPQSLPTYIEAINLNKNLFLVHPKV
ALVSGFPEIFYLMNSLFGGEQRCMKFFRVNQLFILGCNIFQFHYQKQNRFEFQTHQDPFA
IKSKDGLAPHQDQILNFINYFGIQFGFDNLFDLISWETKVGQDVVYQTPIPIIKCIVDIF
VRCLIYMPSKKQIHFANNLKKRIFDRFNKISDRELKDIDIIKVKSTINQLGECLVNILGN
QIYEEAEKLEIKCIIKLIKCPFLEKKILGVLQFREIISRASANNKQYYSKDIYPYQYFDK
QKLKEYLEQENLLDFFLGENFHPEIFKRSIEILTFLSEENALLPKHIEQIWKLTENKHEA
DLAAIYSVIIELSKILQEQSLNQLYKYINSIPFDQYTELTINLVKEFTLNATSSMNFSQQ
SKNQFWKNKSIVLSQEFPNFGLPKLWGCIQDSNKVSNQLVSTCVESLSELFKSNYFSSNK
EQYLQLCFDNLKNGTSVPQSLQLAIFLIKTYSSNSSFLGVGDLNSESITQKYNKDYNFME
AIVKDFENYMRQVLQKIKKTGVILDEKQGEEVFIGKYGHIQNIDIRLDFISLINKYLSSK
QKDITIEQLKKLWKILVRSSITNIEKNKFLTWLIKKKQINNENSNNGKNVASSLLDENLL
SQALDQIFCDKELMNGFQIDKEIFDCLKNIFQMVNLKNKSIELNNQYLILINKYDQIVGK
EVFWNLSLFCIDPQVLEEVRQLLVNIHLRKTLKSQETKPKMWVKFTDKCYEILSQTKSPQ
VQSHIVLMIKIFLQEIEGKMLFGDRRQEMNIVVTLLNQNNNVQKRATLKLQSNISILKLR
KEISREFKLINKDFEMLFSNKNILLSKIHEEEYSIDALNTNDDKPPHIIVQNVKDINQDL
IDLSQFKFNLANSQFADILLEFLSTGQSDEIVNNAWDILNLIPKNNQIVKKLQSIETEEL
NPSSWNLLLPSNCFRKLQYFFQIITQEFLMAGSDGNLKRDQDQWCQAFILKGGLKHILTI
YLNLCSETNFDKPFNLYCISTLVEIIGALMRLYYNQFPKEFLIESQKVTSQNEFLNALVQ
RTINYIGFGLKKSDQFFSPFGSSSLSMSQSLSQLASSIIINGNRIVNDQNLSVNRLLVQN
YLLSFFRGAFELISLCFEQDESLIKTYLHEQSKNFDPIFQGLLILDDDQIRNQLQNSLVK
VIDLDSTNQAHIIFENNLSKIIQSKHDQIQNEYRSKCYEFFQLYQKVLQHLEDKRLIGTT
VNPKSFTQTMQTIISLIDTCNPYEKTRQDVDGMLRGAFQCLQQLIQMDSLLAQVVIKNEK
LIQKIIYDCLFSIKSDENPYAPKCKSRQSRLSAFSFLVTLQNSIIQQQIEEKDIVNEEFD
ANQQINQFFVNAHWRTKSKGDWSIKEEQEKEENCPIGLRNLGCTCYMNSLIQQLFMIREF
SDSLQKVDASTSEKEYNSKENVLYQVQQIFSALSYSQRQYYDPRDFCQAFKDLDGQPTNV
FQQMDVDEFFNTLMDRLETLLKPSKNDFIIKNIFEGQLANELIGKGGGCTHNSEREESFL
AISLPAKSKKTLYECLQSFVQGEMLDGDNSYFCEKCDKKVPTLKRQSIKKLPNQLIIVLK
RFHFDLDVMQKIKINSYCEFPDKLNLKQYSQAYLKQKDLEEDLNQQNEQGDASSKQSDIK
KIDGQEDNIQDQLSELFPDDYYKYNLKGVVIHQGTSDSGHYYSLIKQQDEKWLEFNDTVV
RPFDINDLPSEAFGGESDLQFNNGNQSMNLNNKMQNTNNKNAYLLFYERDVFFDNEGKPI
PSILDQNLIQNPTNLTKENIVLENKKLHLNKYLFSHEMIEYTQKLLEIIDPDNQTDYSNK
LCKFLIKYYFFCRQRQNDKKEFPNFRKKLGEILSKNYNLSTWLIYNASNESFIKENFLDS
QHDEMKYLSAGLIIEAINCVCAQENNLPYETFIKKSVIVYFLNISIYILHTQSPTDIKVL
DQFYRMLCRVAEVSKNSRQYLLKQKMVGRLQAGFMGTRQTANGYQDINNYKQQGQAENSE
FGLDLQVEQEKSQKIQSIDEILEGKERNKRLNQLQKNVSYLVKMHSILVRSVSPFINCQI
PENTYLALPRIDHALDSDEIETFKQQAFVKFIFNQNIQYKKMVRNYLAQTYAYLTAENPQ
LTKDLMDNMYAIFNDYRFDDISIKFYFIFLKHFLLINDSQEKKRAILVKQKIQSFISQNY
KFFYAAQICIDSMIKLSTLSKNFAQEMSKEIQENKDLARCFDYFLRESSNIYNALNNNSM
ALFKDNRQYNLNIQAIQKYQQNIKSQNNLRRQKIQNLQTLCNQPLEYDSDDDYAEKTVKI
NDRVDYRQNGEINSFVVVDSMVDMFQITSEKEANYFRWVKYDDDSLLEPIKAQKYYQYYY
DYLHF
NT seq 7758 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgtttagcaacttaactaaagttagactccagacaagaaagtgtaataagtg
aatcctattctggaagatctgcaaagatatcttgctgaattaaaaaattattcgttgtag
aagttttgcacagtcaattcttatatagatgcgatggatagtcgtaattaatggtgtgtt
ggtaaaatcattagcattgatcagaaaggcatgatggacattcgttttgatggttggtct
gacaagtatatagagtgtttttattgtagtaaaatgcttttataatctaaaatttctaaa
cttagtatcagcataggcaaataataaaagggaattttagcagtgtgggtttagaagtac
acttttccatatacaggagctataaaatcaactacaagagatgatttgactatcgaaaaa
atgagagaagaatcaaacgcataaattgaggaattgagtcttttggaaaacgatgatttc
aatatttaaaacgtgaatacttttatacaaaacttcagagggagatacttctttttagca
gactatattttgagcattaataaaagtttctaggataatgacattcaatagtttatagaa
ttcttttaaatatatatcaaggtctttataaagtatattaaattgctgccatagtcactt
cctacttatattgaagcaattaatttgaataaaaatctttttttggtacacccaaaagtc
gctttggttagtggatttccagaaatattctatttgatgaactctttgtttggaggagaa
taaagatgtatgaaattctttagagtaaattaattattcattttaggatgcaatatattt
caatttcattatcaaaagtaaaatagattcgagttttaaacacaccaagatccttttgcc
atcaaaagcaaagatggtttagcaccccattaagatcagattttgaactttattaattat
tttggaatacaattcggatttgataatttattcgatttaatttcttgggaaactaaggta
ggtcaagatgttgtctattaaactcctatccctataattaaatgcatagtggatatattt
gttagatgccttatctacatgccatctaaaaagcaaattcattttgcaaataacttgaaa
aaaagaatatttgataggttcaataagatctcagatagagaattaaaagatatagatatt
attaaggttaaaagcaccattaattagctaggtgaatgtcttgttaatattttaggaaat
taaatctacgaagaagcagagaaattagaaattaagtgcattatcaagcttattaagtgt
ccatttttagaaaaaaaaattttaggagttttgcaatttagggaaattataagcagagct
agtgcaaataacaagtagtattactctaaggatatatatccttattaatattttgacaaa
tagaaactcaaggaatatttagaataagaaaatttacttgacttttttttgggagagaat
ttccatcctgaaatatttaaaagatcaatagaaatattaacctttttaagtgaagaaaat
gccttgctacctaaacacattgaacaaatttggaagcttacagaaaataagcatgaagct
gacttagcagctatatactcagtcattatagaattatctaagattttataagaataaagc
cttaatcagttatataaatacattaattcaattccattcgatcaatacactgaattaaca
attaatttagtcaaggaatttacattaaacgctacctcttctatgaatttttcataataa
tccaaaaatcaattctggaaaaataagagcatcgttttgtcacaagaattcccaaatttt
ggtttgccaaaattatggggttgcatctaagatagcaacaaagttagtaattaactagtt
tctacctgtgttgagtcgctcagtgagcttttcaagtcaaactatttctcgtcaaataaa
gaacaatacttataactttgctttgataatcttaagaatggaacaagcgtacctcaaagc
cttcagctagctatatttttaataaaaacttactcctctaattcttccttcttaggagta
ggagatctaaattcagaatccatcacttaaaaatacaacaaagactacaattttatggaa
gcaatagttaaagactttgagaattacatgagacaagtactataaaagattaaaaagaca
ggagtgatattagatgagaaacaaggagaggaagtattcattggaaagtatggccacatt
taaaatattgacatcagattagatttcatatcgttgataaataaatatctctctagtaaa
taaaaagatatcaccatcgaacagcttaaaaagctttggaaaatcttagtgagaagcagc
ataacaaacatagaaaaaaataaatttttaacttggttaattaaaaaaaagtagattaat
aatgaaaatagcaataatggtaaaaatgtggcatctagtttgcttgatgagaatttgctg
tcttaagcacttgattaaatcttttgtgataaagagttaatgaacggtttccaaatagat
aaggaaattttcgactgcttaaaaaacattttctagatggttaacttaaagaataaatca
atagagcttaataattaatacctcattttaattaataaatatgatcaaattgtaggcaag
gaagttttttggaatttatccttattctgcattgatccttaggtcctagaagaagtaaga
taactcctagttaacatccacttgagaaaaactctaaagtcctaagaaacaaaacctaaa
atgtgggtaaaattcactgacaagtgctacgaaattctcagctagacaaaatctccttaa
gttcagtcccatattgttttaatgataaagattttcctacaagaaattgaaggtaaaatg
cttttcggcgacagaagataagaaatgaatattgttgttactttgctcaaccaaaataat
aatgtataaaagagagctacattgaaattataaagcaatattagtattttaaagttaaga
aaagaaatttcaagagaattcaagttgattaacaaagattttgaaatgctattttcaaat
aagaatatcttactctctaaaattcatgaagaagaatattcaatagatgctcttaataca
aacgatgataaacctcctcacattattgttcaaaacgtcaaagacattaactaagattta
atagacctcagttaattcaagtttaatttggcaaattctcaatttgcagatattttatta
gaatttctctcaactggataaagtgatgagatcgttaacaacgcatgggatattctaaac
ctgattccaaagaataattaaatagtcaaaaagttgtaatctatcgaaaccgaagaatta
aatccttcttcttggaatttactcctgccatctaattgcttcagaaagctttaatatttc
ttttaaattatcactcaagaattcttaatggcaggtagcgatggaaatttaaaaagagac
taagatcaatggtgtcaagcttttatattaaagggaggattgaagcacattcttactatt
tacttgaacttatgcagtgaaactaattttgataaacctttcaacttgtattgcatttcc
actttagttgagattataggagccctaatgagactttattataactaattcccaaaagag
tttttaatagaaagttagaaagttacttcatagaatgaattccttaatgctcttgttcag
agaacgattaactatattggatttggcttaaaaaagagtgattaatttttctctcctttt
ggcagcagctctctttctatgtcatagagtcttagctaattagcttcttctattattatt
aatggtaacagaattgttaatgatcaaaatctttcagtcaataggcttttggtataaaat
tacttactttctttcttcagaggagcttttgaacttatttctctttgctttgagcaagat
gagtctttgataaaaacatatttgcatgaataatctaaaaattttgatcctatcttttaa
ggattattgatcttagatgatgatcagatcagaaatcaattataaaactcacttgttaaa
gttatagatttagattctactaactaggctcatatcatttttgagaataacttgagtaag
ataatctagtctaagcatgatcaaatctaaaatgaatacagatcaaaatgctatgaattc
ttctagctttattaaaaagttctccaacaccttgaggacaagaggttgattggaaccaca
gttaatcctaaatcattcacttaaactatgcaaactattataagtctaattgacacttgt
aatccatatgaaaaaaccagataagatgtggatggtatgttgagaggagctttctaatgt
ttacaataattaatttaaatggattcccttctagcttaagttgtcattaaaaatgaaaaa
ttgatttaaaaaataatctatgattgcttgttctcaataaaatcagatgaaaatccatat
gctccaaaatgtaagtcaagacaaagcagattaagtgccttttcattcttagtcactctc
taaaattcaataattcaacaatagatagaagagaaagatatagttaacgaggaatttgat
gcaaattaataaatcaatcagttctttgtaaatgctcattggagaacaaaatcaaaagga
gattggagcatcaaagaagaataagaaaaagaagaaaactgtcctattggtttaagaaac
ttaggttgcacttgttatatgaattctctcatataataactattcatgataagagaattc
tctgatagtctttaaaaggtagatgcttcaacaagcgaaaaagaatataattctaaagaa
aatgttctttactaggtttaacaaatattcagtgccttgagctactcttaacgctaatac
tatgatccaagagatttttgttaagcatttaaagatttagatggttaacctactaatgtc
ttttaacagatggatgttgatgaattcttcaacactttaatggatcgccttgaaacattg
ttaaaaccctctaaaaatgatttcatcattaaaaatatttttgaaggataacttgcaaat
gaattaattggaaagggtggcggatgcacacacaattctgagagagaagagtccttccta
gctatcagcttacctgcaaaaagcaaaaaaaccttgtatgaatgcctttaaagttttgta
caaggagaaatgctagacggagacaattcttatttctgtgagaaatgcgataagaaagta
cccacattgaagcgttaatcaataaaaaaactaccaaattaacttataattgttttaaaa
cgtttccattttgacttggatgtcatgcagaaaataaaaattaactcatactgcgagttt
cccgataaactaaatttaaagtagtactcttaggcttatttgaaatagaaagatttggaa
gaagacctcaactagtaaaatgaataaggagatgccagttcaaagtaaagtgatattaaa
aaaatagatggacaagaagataacatttaagattaactatccgagttgttccctgatgat
tattataagtataacttaaaaggagttgttatccactaaggcacttcagatagtggtcat
tactacagcttaattaaataataagatgaaaagtggcttgaatttaatgacactgtcgtc
agacctttcgatattaatgatttaccttctgaagcattcggaggagagtctgacttgtaa
ttcaacaatggaaatcaatccatgaatctcaataataaaatgcaaaacacaaacaacaaa
aatgcctatttgctattttatgaaagagatgtattctttgataacgaaggcaagcccatt
ccatctatccttgactaaaacctcatacaaaatcctaccaacttaactaaagaaaacatt
gttttagaaaacaaaaagttgcacttaaacaaatatttattctcccatgagatgattgag
tatacttaaaaactcttggaaataatagaccctgacaactaaactgattattcaaataaa
ctttgcaagttcttgatcaaatattacttcttctgcagacagagataaaatgataaaaaa
gaattccccaattttagaaaaaaattaggtgagatattgagcaagaactataatttaagc
acttggcttatttacaacgcctctaatgaaagctttataaaagaaaatttcttagactca
caacatgacgaaatgaaatatttgagtgctggtttgataatcgaagcaattaattgtgtt
tgtgcataagaaaataaccttccttatgaaacttttataaaaaagagtgttattgtctac
ttcctcaatatttcgatttatatcctgcacactcaatctccaacagatataaaagtatta
gattaattctacagaatgttgtgtagggtggctgaagtttctaagaactccagatagtat
ttgctaaaataaaaaatggttggaagattataagctggatttatgggaacaagatagact
gctaatggttactaggacataaataactataagtagtaaggccaagcagaaaatagtgaa
tttggtctggatctataagttgaataggaaaaatcttagaaaatataatccattgatgag
attttagaaggtaaagagagaaacaaaaggttaaactagctctagaaaaatgtatcttat
ttagttaaaatgcattcgattcttgttagaagtgtttctccttttataaattgttaaata
ccagaaaatacttatttagctcttcctaggatagatcatgcattagacagtgatgaaatt
gaaactttcaagcaacaagcttttgtcaaatttatatttaattagaacatctaatataaa
aagatggtacgtaattatcttgcatagacatatgcttacttaacagctgaaaatccataa
ctaacaaaagaccttatggataatatgtacgcaatctttaatgattataggtttgatgac
ataagcatcaaattttactttatattccttaagcatttccttcttattaatgattctcaa
gaaaagaaaagagcgattttagttaagcaaaaaatatagagtttcatttcacaaaattac
aaatttttttatgctgctcaaatttgcatagatagcatgataaaactaagcacactctct
aaaaactttgcttaagaaatgtctaaagagatataagaaaacaaagatttagcaagatgc
ttcgattacttcctaagagaatcaagcaacatatacaatgccttgaacaataatagcatg
gccctcttcaaagataacagacaatacaatttaaatatttaagcaatttagaaatatcaa
caaaatattaaatcttaaaataatttgagaagacaaaaaatttaaaacttacaaacctta
tgcaactagcctcttgaatatgattcagatgatgactatgcagagaagactgttaaaatt
aatgatagagttgactacagataaaatggagagatcaattcttttgttgtagtagattct
atggttgacatgttctaaataacaagtgaaaaggaagcaaattactttagatgggtaaag
tatgatgacgattcgctccttgaaccaataaaggcttaaaaatattactaatattactat
gattatttgcatttctga

DBGET integrated database retrieval system