KEGG   Tetrahymena thermophila: TTHERM_00923020Help
Entry
TTHERM_00923020   CDS       T01020                                 

Definition
Pyridoxal-phosphate dependent enzyme family protein (EC:4.3.1.19)
Orthology
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
tet  Tetrahymena thermophila
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tet01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tet01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tet00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:tet00290]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 487 aa AA seqDB search
MSTKNGEKIQIQEHLQQQQKQQLKEEMKENPNPEIQKQETKQNSYLYQAASIFKAYKNIR
QIVRRTIIQRSSRLSDLYQANIFFKREDGQITRTYKVRGAVNKILSLTPEEKQKGVYCCS
AGNQVMILYVKMVKNSIRTKEKLFKSKYFKYLLKIFQYKKIQGVAVAFACNHLKVKGIIF
VPQTTPNDKIQRIKEFGKEFIEVKLAGLSLQDCDQIATKYGEDNKLISVRLDEKDVIEGC
SGVGIEILEDFPLKGKIDYVIFPISSGTLGAGISSYFHQLSPETNIIGIKPIFSENEMVY
EDMQKTMQLDAKNTFKVMDDLSNYQELEIPEGEAYDQVLQLYNNDGIILEPHGALAPASL
KLLQEKCGSLKGKNIVCILTGKNTSISRMNDIKILANVYQKKNVYMLVDFFRKPDAIKEF
MVYCLSPEDEILQIEYTKKNNREKGPALVGIELASPGNYDKLLAKMLEMKISHKIIQPND
EIFQLKV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaaaaacggagaaaagatctaaatttaagaacatctataatagcaataaaaa
tagcaacttaaagaagaaatgaaggaaaatccaaaccctgaaatacaaaaataagaaact
aaataaaattcttacttatatcaagcagctagcatttttaaagcttataagaatattcgc
tagatagttcgtagaacaattatttaaagatcctctagattatcagatttatatcaagca
aatatcttctttaaaagagaagatggataaatcactaggacatataaagtgagaggagct
gttaataaaattttatctctaacacctgaagaaaaatagaaaggagtttactgctgctcc
gctggtaactaagtcatgatactttatgtcaaaatggttaaaaattcaataagaactaaa
gaaaaactcttcaaatctaaatattttaagtatttgttaaaaattttttaatataaaaaa
atttaaggtgttgcagtagctttcgcttgtaatcatttgaaagtaaaaggcattattttc
gtaccttaaactacaccaaacgataaaatccaaagaataaaggaatttggcaaggagttt
attgaagttaaattggctggtttatcattgtaagattgtgattagattgctacgaaatat
ggagaagataacaaattaatttcagtaagacttgatgaaaaagatgtcattgaaggctgt
agtggagtaggaatagaaattttagaagattttcctttaaagggaaaaatagattatgta
atatttcctatttcatcaggtactttaggagctggtatttcaagttatttccattagctt
tctcccgaaacaaatattattggtatcaaacctatattttctgaaaatgaaatggtttat
gaagatatgtaaaagacaatgtaacttgatgccaaaaatacatttaaagttatggatgat
ttgtcaaattaccaagaattagaaatacctgaaggagaagcttacgattaagttttacaa
ttatataataacgatggaattatcttagaacctcatggtgctcttgctcctgcaagcttg
aagcttttataggaaaagtgtgggtcacttaaaggtaaaaatattgtttgcattttgact
ggtaaaaatacaagtatatctcgtatgaacgatatcaaaatacttgcaaatgtgtactag
aaaaaaaatgtatatatgcttgtagattttttccgtaagccagatgctatcaaggagttc
atggtttactgtctatctcctgaagatgaaattctttaaatcgagtataccaaaaagaat
aatcgtgagaaaggaccagcgttagtgggaatcgagctagcaagtcctggaaactatgat
aagttattagctaaaatgctagaaatgaaaatatctcacaaaataatttaacccaacgat
gaaatattctaattaaaagtctga

DBGET integrated database retrieval system