KEGG   Tetrahymena thermophila: TTHERM_00923020Help
Entry
TTHERM_00923020   CDS       T01020                                 

Definition
Pyridoxal-phosphate dependent enzyme family protein (EC:4.3.1.19)
Orthology
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
tet  Tetrahymena thermophila
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHERM_00923020
   01230 Biosynthesis of amino acids
    TTHERM_00923020
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHERM_00923020
   00290 Valine, leucine and isoleucine biosynthesis
    TTHERM_00923020
Enzymes [BR:tet01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     TTHERM_00923020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 487 aa AA seqDB search
MSTKNGEKIQIQEHLQQQQKQQLKEEMKENPNPEIQKQETKQNSYLYQAASIFKAYKNIR
QIVRRTIIQRSSRLSDLYQANIFFKREDGQITRTYKVRGAVNKILSLTPEEKQKGVYCCS
AGNQVMILYVKMVKNSIRTKEKLFKSKYFKYLLKIFQYKKIQGVAVAFACNHLKVKGIIF
VPQTTPNDKIQRIKEFGKEFIEVKLAGLSLQDCDQIATKYGEDNKLISVRLDEKDVIEGC
SGVGIEILEDFPLKGKIDYVIFPISSGTLGAGISSYFHQLSPETNIIGIKPIFSENEMVY
EDMQKTMQLDAKNTFKVMDDLSNYQELEIPEGEAYDQVLQLYNNDGIILEPHGALAPASL
KLLQEKCGSLKGKNIVCILTGKNTSISRMNDIKILANVYQKKNVYMLVDFFRKPDAIKEF
MVYCLSPEDEILQIEYTKKNNREKGPALVGIELASPGNYDKLLAKMLEMKISHKIIQPND
EIFQLKV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaaaaacggagaaaagatctaaatttaagaacatctataatagcaataaaaa
tagcaacttaaagaagaaatgaaggaaaatccaaaccctgaaatacaaaaataagaaact
aaataaaattcttacttatatcaagcagctagcatttttaaagcttataagaatattcgc
tagatagttcgtagaacaattatttaaagatcctctagattatcagatttatatcaagca
aatatcttctttaaaagagaagatggataaatcactaggacatataaagtgagaggagct
gttaataaaattttatctctaacacctgaagaaaaatagaaaggagtttactgctgctcc
gctggtaactaagtcatgatactttatgtcaaaatggttaaaaattcaataagaactaaa
gaaaaactcttcaaatctaaatattttaagtatttgttaaaaattttttaatataaaaaa
atttaaggtgttgcagtagctttcgcttgtaatcatttgaaagtaaaaggcattattttc
gtaccttaaactacaccaaacgataaaatccaaagaataaaggaatttggcaaggagttt
attgaagttaaattggctggtttatcattgtaagattgtgattagattgctacgaaatat
ggagaagataacaaattaatttcagtaagacttgatgaaaaagatgtcattgaaggctgt
agtggagtaggaatagaaattttagaagattttcctttaaagggaaaaatagattatgta
atatttcctatttcatcaggtactttaggagctggtatttcaagttatttccattagctt
tctcccgaaacaaatattattggtatcaaacctatattttctgaaaatgaaatggtttat
gaagatatgtaaaagacaatgtaacttgatgccaaaaatacatttaaagttatggatgat
ttgtcaaattaccaagaattagaaatacctgaaggagaagcttacgattaagttttacaa
ttatataataacgatggaattatcttagaacctcatggtgctcttgctcctgcaagcttg
aagcttttataggaaaagtgtgggtcacttaaaggtaaaaatattgtttgcattttgact
ggtaaaaatacaagtatatctcgtatgaacgatatcaaaatacttgcaaatgtgtactag
aaaaaaaatgtatatatgcttgtagattttttccgtaagccagatgctatcaaggagttc
atggtttactgtctatctcctgaagatgaaattctttaaatcgagtataccaaaaagaat
aatcgtgagaaaggaccagcgttagtgggaatcgagctagcaagtcctggaaactatgat
aagttattagctaaaatgctagaaatgaaaatatctcacaaaataatttaacccaacgat
gaaatattctaattaaaagtctga

DBGET integrated database retrieval system