KEGG   Tetrahymena thermophila: TTHERM_00939200Help
Entry
TTHERM_00939200   CDS       T01020                                 

Definition
EF hand family protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tet  Tetrahymena thermophila
Brite
Protein phosphatases and associated proteins [BR:tet01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TTHERM_00939200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 222 aa AA seqDB search
MGNGSSNKKKEKNIDQTLQDLQKNQSRSQKYDPFADVEIQRLREKFRLLSDNKPTLTLNG
FKQLLELKTHFFRERIFQLVEAEMTKRNKTDIDFDYFIKVLTPFHPLTSIDSKYKLLFDI
YDINADNLISQDDIKATMKIIYSIQISKDKKDNQNQEENYRKRNAELEEVKEAFMANQDY
LDSLAKDIMNDFDKDRSGELDFGEFKELVDNLDLQFRLNINF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatggttcttctaataaaaaaaaagaaaaaaatatagattaaactttacaggat
ttgcaaaaaaattagagcagatcataaaaatatgatccttttgctgatgtagaaatataa
aggttaagagaaaaattcagattattatctgacaataagcctacattgacgttaaatgga
ttcaagcaactccttgaacttaagacgcatttttttagagaaagaattttttagctagtg
gaagctgaaatgacaaaaagaaataaaactgatatagattttgattatttcattaaggtg
ctaactcccttccatcctttaacttcaattgattcaaaatacaagctcttatttgacatt
tatgatataaacgcagataatctaatttcttaagatgacattaaagccactatgaaaatt
atttattcaatttagatatctaaagataaaaaagataattaaaactaagaagaaaattat
aggaaaagaaatgctgaattggaagaagttaaggaagcatttatggcaaactaagattac
ttagattcattagctaaagatataatgaatgattttgacaaagacaggagtggagaactt
gattttggtgaatttaaagaattagttgataatctagatctgtaatttagattaaatata
aatttttga

DBGET integrated database retrieval system