KEGG   Tetrahymena thermophila: TTHERM_01005160Help
Entry
TTHERM_01005160   CDS       T01020                                 

Definition
protein disulfide-isomerase domain containing protein (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tet  Tetrahymena thermophila
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TTHERM_01005160
Enzymes [BR:tet01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TTHERM_01005160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 430 aa AA seqDB search
MSKLLALALILSLLGTALALYDNNSKVIKLNKSRFQNEVINSKELWLVEFFAPWCGHCKS
LAPEWEKAAKALEGIVKVGAVDMTTDQEVGSPYNIQGFPTIKFFGDNKSKPQDYNSGRTA
NDLINYALNEAKSIAQRRLSGGSSSSGNRQSGGSKGNANADNDGDVVVLTDDNFDANVVG
SKEPWFIEFYAPWCGHCKNLQPEWNKLATEMKTEGVKVAKVDATVHPKVAQRFGVNGYPT
IKFFPAGFSSDSEAVDYNGGRDASSLGSWAKEQRDAKKPIMFTQLLNQSIYDEYCTNNSG
VCIIFLLPHIYDSSAAQRNGYINLITEIAQANKGRPITYLWSQGGDQYDFEEKLNAGGSG
YPSAMAISHKKNLYQIFKGSFKKKDLDSFISGLLTGRGSFSTLPTLPKIKKVKEWDGQDA
EQQQTDNSDL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattattagctttagctttaatactctcacttttaggtactgctttagctctt
tatgacaataactctaaagtcattaagctcaacaaaagcagattttaaaacgaagtcatt
aactcaaaagaactttggcttgttgaattctttgccccttggtgtggtcactgtaagagc
ttggctcctgaatgggaaaaggctgctaaggcccttgaaggtatcgtaaaagtcggtgct
gttgatatgactactgatcaagaagttggaagcccttacaacatttaaggtttccccact
atcaagttctttggtgataataagtctaagccctaagattacaacagtggaagaacagca
aatgatttaattaactacgccttaaatgaagctaagagtattgctcaacgtcgtttgagt
ggtggaagcagctcatctggaaacagataatcaggaggctctaagggtaatgctaatgct
gataatgatggtgatgttgttgttttaaccgatgataactttgatgccaatgtagttgga
agcaaagaaccttggttcattgaattttatgccccttggtgtggtcactgcaagaattta
taacctgaatggaataagttagctactgaaatgaagactgaaggtgttaaggttgctaag
gttgatgctacagtacatcctaaagttgctcaacgttttggagttaatggttatcccacc
attaaattcttccctgccggtttctccagtgactctgaagctgttgattacaatggtggc
agagatgcttcttcattgggaagctgggctaaggagcaaagagatgctaaaaaacctatt
atgttcactcaacttctcaatcaatctatttatgatgaatactgcactaacaactctggt
gtttgcattatcttccttcttcctcatatttatgattcttctgcagctcaaagaaatgga
tacatcaatttaattactgaaatcgcccaagctaataagggaagacctattacttactta
tggagttaaggtggtgattaatacgatttcgaagaaaagcttaatgctggaggcagtggt
tatccttctgctatggcaatttctcataagaaaaatctctaccaaatctttaaaggttct
ttcaagaagaaagacttagatagcttcatttctggattactaactggtcgtggtagcttc
tctactttacctactcttcctaaaatcaaaaaggttaaggaatgggatggttaagatgct
gaataataacaaactgataacagcgatctttga

DBGET integrated database retrieval system