KEGG   Tetrahymena thermophila: TTHERM_01005260Help
Entry
TTHERM_01005260   CDS       T01020                                 

Definition
3-hydroxybutyrate dehydrogenase family protein (EC:1.1.1.30)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 263 aa AA seqDB search
MLANLSNKVALITGSTSGIGLACAHTLAKAGANIVLNGFGDANEIERIRQNIENTYKVKS
IYANYNLMKPTEIKQMIEHVNKTFGGVDILINNAGMQHVTPIEDMPEDMYEKIIALNLSS
NFYTIKYCIPHMKKRNWGRIINIASVHGKVASVNKAPYVASKHGVIGLTKVVALENAQTG
VTCNAICPGWVLTDLIKKQIEALSQKNNTTFEEGAKALLKEKQPSQQFVRPEQIGETALF
LCSDSASEIRGEAICVDGGWVAI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaaatctctccaacaaagttgctttgattactggttccaccagtggtattggt
cttgcatgtgctcacaccttagctaaggctggtgcaaacattgttttaaatggttttggt
gatgccaatgaaatcgaaagaatcagacaaaacatcgaaaacacttacaaggttaagtcc
atctatgctaactacaacttaatgaaacctactgaaattaagtaaatgatcgaacacgtc
aataaaactttcggtggagttgatatcctcatcaacaatgctggtatgtaacacgttacc
cctattgaagacatgcctgaagatatgtacgaaaagattattgccttaaacttatcctct
aacttctacaccattaaatactgtatccctcacatgaaaaagagaaactggggtagaatt
attaacattgcttcagtacatggtaaggttgcttcagtcaacaaggctccttatgttgcc
agtaagcacggtgttattggtttgaccaaggttgttgctttggaaaatgcccaaactggt
gtaacttgcaatgccatttgccctggttgggtccttactgacttaattaagaaataaatt
gaagccttatcctaaaagaataacaccactttcgaagaaggtgctaaagctttacttaag
gaaaagcaaccctctcaataattcgttagacctgaataaattggtgaaactgccctcttc
ctctgctctgactctgcttctgaaattagaggtgaagctatttgtgttgatggtggttgg
gttgctatctga

DBGET integrated database retrieval system