KEGG   Tetrahymena thermophila: TTHERM_01018410Help
Entry
TTHERM_01018410   CDS       T01020                                 

Definition
Thioredoxin family protein (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 352 aa AA seqDB search
MNKIIVFCLVLAIVSVSGRQWFHDVKATSLNPELFDQLVGKDNHYFVEFFTPWCGYCQQM
AGEWNKLFSHYEETQETRKDVKIAKINCDDHQRLCIANDVRQYPTVLLYKAGNKRPTHQY
QGWRKFEDFRDFIETHAPKPVQENPQEANDDQAKAQQLNEEEQKLKEQEELIRQHEEAIE
RQHREQLLLLQRQEEEDRLRRQQEERIRLEAEQKLREIEEERIRKLQEEQNRINAQIDIV
EQYLKHQKEVAQSLHSEIQKLQAEVKSLKSGSQDKENEGQQQQQQNQQQVKPDQQKKPNK
NALPVEKSFNIMHSIIFIAVGVCIGYIFFKFFSRQKSPASLLISHDQLGKSN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataatagtattttgtttagtattagcaatagtatctgtatcaggtagataa
tggtttcatgatgttaaggctacttcattgaatcctgaattatttgattaacttgttgga
aaagataatcattattttgtagaattctttactccttggtgcggttattgttaataaatg
gctggtgaatggaacaaactgtttagccattatgaggaaacctaagaaactcgtaaagat
gtgaaaatagctaaaataaattgcgatgatcattaaagactttgtattgctaatgatgtt
agacaatatcccactgttttactctataaagcaggaaataagagaccaactcattagtat
taaggatggagaaaatttgaagattttagagattttattgaaacacatgctcctaagcca
gtttaggaaaacccataggaagcaaatgatgattaagcaaaagctcaataattaaatgaa
gaagaataaaagttaaaagaataggaagaattgattagacaacatgaagaagcaattgaa
agatagcacagagaatagcttttgttactacaaagataagaagaagaagacagattaaga
agataataagaagaacgaattaggttagaagctgagcaaaaattaagagagattgaagaa
gaaagaattagaaaattacaagaagaataaaacagaattaatgcttagattgatatagtc
gaataatatctcaagcattaaaaagaagttgcataatctcttcactctgaaatctaaaaa
ttacaagcagaagtaaagtctctaaagtcaggctctcaagataaggaaaacgaaggacaa
taatagtaacaacaaaactagcaataagttaagccagactaacaaaaaaagcctaacaaa
aatgcattaccagttgaaaaatcatttaacattatgcattcaataatttttatagccgta
ggtgtctgcattggctacattttcttcaaattcttttcaagataaaaatctccagcttca
ttactcatctcacatgattaattaggaaaaagtaattga

DBGET integrated database retrieval system