KEGG   Tetrahymena thermophila: TTHERM_01018410Help
Entry
TTHERM_01018410   CDS       T01020                                 

Definition
(RefSeq) thioredoxin
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 441 aa AA seqDB search
MHINIFILFQLNFLKKLQKLNIFTNRNMNKIIVFCLVLAIVSVSGRQWFHDVKATSLNPE
LFDQLVGKDNHYFVEFFTPWCGYCQQMAGEWNKLFSHYEETQETRKDVKIAKINCDDHQR
LCIANDVRQYPTVLLYKAGNKRPTHQYQGWRKFEDFRDFIETHAPKPVQENPQEANDDQA
KAQQLNEEEQKLKEQEELIRQHEEAIERQHREQLLLLQRQEEEDRLRRQQEERIRLEAEQ
KLREIEEERIRKLQEEQNRINAQSNQQEQAQNQNQNNQANDSAIMNQINQVLQQTRSIQH
QIQQVPQIQSLVHQLKVNLDYTIQKVDIVEQYLKHQKEVAQSLHSEIQKLQAEVKSLKSG
SQDKENEGQQQQQQNQQQVKPDQQKKPNKNALPVEKSFNIMHSIIFIAVGVCIGYIFFKF
FSRQKSPASLLISHDQLGKSN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcatataaacatattcatactattttaattaaactttctaaaaaaactttaaaaatta
aatatatttacaaataggaatatgaataaaataatagtattttgtttagtattagcaata
gtatctgtatcaggtagataatggtttcatgatgttaaggctacttcattgaatcctgaa
ttatttgattaacttgttggaaaagataatcattattttgtagaattctttactccttgg
tgcggttattgttaataaatggctggtgaatggaacaaactgtttagccattatgaggaa
acctaagaaactcgtaaagatgtgaaaatagctaaaataaattgcgatgatcattaaaga
ctttgtattgctaatgatgttagacaatatcccactgttttactctataaagcaggaaat
aagagaccaactcattagtattaaggatggagaaaatttgaagattttagagattttatt
gaaacacatgctcctaagccagtttaggaaaacccataggaagcaaatgatgattaagca
aaagctcaataattaaatgaagaagaataaaagttaaaagaataggaagaattgattaga
caacatgaagaagcaattgaaagatagcacagagaatagcttttgttactacaaagataa
gaagaagaagacagattaagaagataataagaagaacgaattaggttagaagctgagcaa
aaattaagagagattgaagaagaaagaattagaaaattacaagaagaataaaacagaatt
aatgcttagagtaatcaataagaataagcttaaaattaaaattagaataattaggctaac
gattcagctattatgaactaaattaatcaagttttataataaactagaagcatttagcat
taaattcagcaagtgccttaaatccaatcactagtccattaactcaaagttaacttggat
tatacaatttaaaaagttgatatagtcgaataatatctcaagcattaaaaagaagttgca
taatctcttcactctgaaatctaaaaattacaagcagaagtaaagtctctaaagtcaggc
tctcaagataaggaaaacgaaggacaataatagtaacaacaaaactagcaataagttaag
ccagactaacaaaaaaagcctaacaaaaatgcattaccagttgaaaaatcatttaacatt
atgcattcaataatttttatagccgtaggtgtctgcattggctacattttcttcaaattc
ttttcaagataaaaatctccagcttcattactcatctcacatgattaattaggaaaaagt
aattga

DBGET integrated database retrieval system