KEGG   Tetrahymena thermophila: TTHERM_01020820Help
Entry
TTHERM_01020820   CDS       T01020                                 

Definition
Protein kinase domain containing protein (EC:2.7.11.1)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 388 aa AA seqDB search
MQISEEQFFEQFQIKLIQLAKIKQREEQQNRNGDIQQSEPFVEDDLISEFNHLIEIPLNQ
QGKIQTKSDTMKISDFEIFATLGTGTFGRVRQVKLKGDTNKEIFALKMLKKTEIVRLNQV
EHINSEKKILQSVKHPFIVQMKQSFQDDKYIYMLFEYIQGGELFSRLRKEGRFSNDVGLF
YTCQILLALQYLHQHDIVYRDLKPENLLIDKEGNIKITDFGFAKKLDNDRTFTLCGTPEY
LAPEIIKGSRVGYGKSVDWWALGILVFEMLSGYPPFYDNEPIGIYKKIIAGIIEFPRFFD
NKAKDLIRKLLNPDLNYRLGVHDKGQSVSKHKWFRGVDWESVFNKDIPAPWTPQLRNEQD
ASCFEKYPDSQEGARSLPRDLQHLFEDF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtaaattagtgaggaatagtttttcgaatagtttcaaataaagctcatttagctagct
aagattaaataaagagaggagtagtaaaatagaaacggggacatttagcagtcagaaccc
tttgtagaagatgacttaattagcgaattcaaccatcttatagaaatacctttaaattaa
taagggaaaatatagactaagagtgatacaatgaagataagcgattttgaaatatttgca
acattaggtactggaacatttggtagagtgagataagtaaaacttaaaggggatactaac
aaagaaatatttgctttaaaaatgctaaagaaaacagaaatagtaagattaaattaagtt
gagcacataaattcagaaaagaagattttatagagtgtgaagcatccttttatagtataa
atgaaatagagtttttaagatgataaatacatatatatgctttttgagtatattcaagga
ggtgaattatttagcagactaagaaaagaaggcagattttctaatgatgtaggcttattc
tatacctgctaaatcttgcttgctttacagtatttgcattaacatgatatagtttataga
gatttaaagccagaaaatcttcttattgacaaggaaggcaatattaaaataactgacttt
ggatttgctaaaaaattagataatgatagaacatttactctttgtggtactccagaatat
cttgctcctgaaattataaaaggttctagagttggctatggaaaatcagttgattggtgg
gcattgggtatattagtattcgaaatgctttcagggtatcctcccttttatgataatgaa
cctattggcatttataaaaagattatagcaggtataatagaattccctcgtttctttgac
aataaagctaaagatttaattagaaaattactaaaccctgatcttaactataggttagga
gttcatgataaaggataaagtgtttccaaacataaatggtttagaggtgtagattgggaa
agtgtatttaataaggatatacctgctccttggactccgtaactcagaaatgaataagat
gcatcttgctttgaaaagtatccagattcttaagaaggagcaagaagcctaccaagagac
ctctaacatctctttgaagatttttga

DBGET integrated database retrieval system