KEGG   Tetrahymena thermophila: TTHERM_01020820Help
Entry
TTHERM_01020820   CDS       T01020                                 

Definition
Protein kinase domain containing protein (EC:2.7.11.1)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TTHERM_01020820
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   TTHERM_01020820
Messenger RNA biogenesis [BR:tet03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TTHERM_01020820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 388 aa AA seqDB search
MQISEEQFFEQFQIKLIQLAKIKQREEQQNRNGDIQQSEPFVEDDLISEFNHLIEIPLNQ
QGKIQTKSDTMKISDFEIFATLGTGTFGRVRQVKLKGDTNKEIFALKMLKKTEIVRLNQV
EHINSEKKILQSVKHPFIVQMKQSFQDDKYIYMLFEYIQGGELFSRLRKEGRFSNDVGLF
YTCQILLALQYLHQHDIVYRDLKPENLLIDKEGNIKITDFGFAKKLDNDRTFTLCGTPEY
LAPEIIKGSRVGYGKSVDWWALGILVFEMLSGYPPFYDNEPIGIYKKIIAGIIEFPRFFD
NKAKDLIRKLLNPDLNYRLGVHDKGQSVSKHKWFRGVDWESVFNKDIPAPWTPQLRNEQD
ASCFEKYPDSQEGARSLPRDLQHLFEDF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtaaattagtgaggaatagtttttcgaatagtttcaaataaagctcatttagctagct
aagattaaataaagagaggagtagtaaaatagaaacggggacatttagcagtcagaaccc
tttgtagaagatgacttaattagcgaattcaaccatcttatagaaatacctttaaattaa
taagggaaaatatagactaagagtgatacaatgaagataagcgattttgaaatatttgca
acattaggtactggaacatttggtagagtgagataagtaaaacttaaaggggatactaac
aaagaaatatttgctttaaaaatgctaaagaaaacagaaatagtaagattaaattaagtt
gagcacataaattcagaaaagaagattttatagagtgtgaagcatccttttatagtataa
atgaaatagagtttttaagatgataaatacatatatatgctttttgagtatattcaagga
ggtgaattatttagcagactaagaaaagaaggcagattttctaatgatgtaggcttattc
tatacctgctaaatcttgcttgctttacagtatttgcattaacatgatatagtttataga
gatttaaagccagaaaatcttcttattgacaaggaaggcaatattaaaataactgacttt
ggatttgctaaaaaattagataatgatagaacatttactctttgtggtactccagaatat
cttgctcctgaaattataaaaggttctagagttggctatggaaaatcagttgattggtgg
gcattgggtatattagtattcgaaatgctttcagggtatcctcccttttatgataatgaa
cctattggcatttataaaaagattatagcaggtataatagaattccctcgtttctttgac
aataaagctaaagatttaattagaaaattactaaaccctgatcttaactataggttagga
gttcatgataaaggataaagtgtttccaaacataaatggtttagaggtgtagattgggaa
agtgtatttaataaggatatacctgctccttggactccgtaactcagaaatgaataagat
gcatcttgctttgaaaagtatccagattcttaagaaggagcaagaagcctaccaagagac
ctctaacatctctttgaagatttttga

DBGET integrated database retrieval system