KEGG   Tetrahymena thermophila: TTHERM_01044750Help
Entry
TTHERM_01044750   CDS       T01020                                 

Definition
FAD binding domain containing protein (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     TTHERM_01044750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 912 aa AA seqDB search
MGSCQSQCNSFTNNQIVEEEVQYGKNQAIPNDVQSPELNEQKKKSIGNNVYTQQQSTQNT
SASNVNGKLNSSQSKTQNSTKKEQNYESVQCPVNPLNNSRGSEMRGNEIKWKNIKQRAVL
NIFYGTTQGTTSELATQFASECEQNGFYVRVIHIQTFEPKMLRNCNLVIFFLASYGIMGG
PTDDAQQFYLWLNNFDNQGKPLSSLNYSIFGLYNSKMKKLTVQTNANHDTEVDSTNNIEP
SSYINNNMNSQRQDNEEIEANMNQSVRFQKAMNKKQTKIKSMGQRIDMLFQEVGAKRFYN
FVQVDSSKDELLKESFNQFKNGMITLLTQKFEFQEKPEDAIYNEALLYNLNIYICSIDKL
PKGANNRKELEQMFNIKNVQSRGQYVLKDELWDYFNSTDVPILKMQYLVCDGIKDTITVH
SYTQQSQSNVIAHASRQGISSKLFNQQHQYMLIDLDVSKLPSPPGKPKFETGGLIQIYPQ
NDDASIKRLCEFLGLNENAVISLSIKEQSYNPCNITVSELKYPIPFPITVKQYMKEYLDI
HGKLDKNQVFELANFASDQVDKETLNNICKFSERERFDKEIYEQEQHSLLSLIINYNIKV
PFHILFGLGNLIKPRTFIISSSFLQNPNIIQLTVRIHLRNIPKLNDEITENFQASSNRLR
KSEVQEEEIAKSRHNSLAKVSNPMETRSLGLISNYFLDLYQEIQKQKPQEVRIKSSPNPF
QLPLNEINIRVVLICIDEGIGFFRSYLQEIRQVNNCHNHEIYLYYGSRLLQNNEYLYQNE
LQEFEKEGILKKLEVALTTSNNMEISSRDNKSEKIQLESVSISNISTKNNTSSIQLLLES
QLDQFSQLIEHIDEKESNVKIYISGSQLMSQGILGAIAKSYCQNKKVSQYAAFNTVLNLE
NDGKIVRIIWES
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgggatcatgccaaagttagtgcaactcgtttacaaataattaaatagttgaagaagaa
gtgtagtatggaaaaaattaagcgatacccaatgatgtataatctcctgaactaaatgag
tagaaaaaaaaatctatagggaataatgtttatacttagcagcaatctacttagaatact
tcagcttcaaatgttaatggtaaacttaacagctcacaaagcaaaacctaaaattcgaca
aaaaaagaataaaattatgaaagcgtataatgtccagtcaatccattaaataatagtaga
ggcagtgaaatgagaggcaatgagataaaatggaaaaacattaaataaagagccgtttta
aatattttttatgggactacgcaaggtacgactagtgagttagccacttaatttgcaagt
gaatgcgaataaaatggtttttatgtaagagtaattcatatacagacatttgagcctaaa
atgcttagaaattgcaatttagttatcttttttttagctagctatggaattatgggtggt
cctacagatgatgcccagtaattttatttgtggctaaataattttgacaactagggtaaa
cctctttcctctttaaattatagtatttttggcttatacaactctaaaatgaagaaatta
acagttcaaacaaacgcaaatcatgatactgaagtagatagcacaaataatattgaaccc
agtagctatataaataataatatgaatagttagaggtaagataatgaagaaattgaagca
aatatgaattaaagcgtaaggttttaaaaagccatgaataaaaaataaactaaaataaaa
tcaatgggctagagaatagatatgctattctaggaagtaggcgctaagagattttacaat
tttgtataggtagatagctctaaggatgaacttttaaaagaaagttttaattagttcaaa
aatggtatgataactctccttacataaaaatttgagtttcaagaaaagccagaggatgct
atatataacgaagccctactttataatttgaacatatatatttgctctatagataaatta
ccaaaaggagcaaataaccgaaaggaacttgaataaatgtttaatattaaaaacgtacaa
agcagaggtcaatatgtattaaaagatgagctatgggactatttcaattcaacagatgtt
cccattttaaaaatgcaatatcttgtatgtgatggtattaaggatacaattactgtacat
tcatacacttaacaaagtcagagtaatgttattgcgcatgcctctagataaggaattagc
tctaagctattcaattaacaacactaatacatgctcattgaccttgatgtttccaagtta
ccatctcctcctggtaaacctaaattcgaaacaggaggattaattcaaatttatccttaa
aacgatgacgctagcataaaaagactttgcgaatttttaggactaaatgaaaatgctgtc
attagtttatcaatcaaagaataaagctacaacccatgcaatatcactgtttctgaatta
aaatatcctatcccgttccctataacagtgaaataatatatgaaagaatatcttgatatt
catggtaaacttgacaaaaattaagtctttgagttagcaaattttgctagcgattaagtt
gacaaagaaacactaaataatatctgcaaatttagtgaaagagaaaggttcgataaggaa
atatatgagcaagaataacactcgttattatctctcattattaattataacatcaaagtt
ccatttcatattctctttggacttggtaatttaataaaaccaagaactttcataatcagt
tcaagctttttacaaaatccaaatataatacaattaaccgtaagaattcatctacgtaac
attcctaaacttaatgacgaaataacagagaatttttaggcatcatcaaatagattaagg
aaatcagaagtataggaagaggaaatagcaaaatctagacataattcattagctaaagta
tctaatcctatggaaaccagaagccttgggttgatttcaaattattttttagatctttat
taagaaattcaaaaataaaaaccataagaagtaagaattaaaagcagtccaaaccctttt
taattaccgctaaacgaaataaatattcgtgttgtactaatatgtattgatgaaggtata
ggattttttagatcatacttgtaagaaataagataagtaaacaattgccataatcatgaa
atatatttgtattatggatctcgcttactttaaaataatgagtatctttatcaaaatgaa
ctctaagaattcgagaaagaaggaatactaaaaaaattagaagttgctctaacaacatca
aataacatggaaatttcttctagagataacaaaagcgaaaaaatttaattagaaagtgtt
tctatcagtaacatatcaactaaaaataatacttcttcaattcaacttctccttgaaagc
tagttggatcaattttcttaactaatagagcacatagatgaaaaagaatcaaatgttaaa
atatatatttcaggatcttagctaatgagccaaggaatattaggagcaatagctaaatca
tattgctaaaataaaaaagtgagttaatatgctgctttcaacacagttctaaatcttgaa
aatgatggaaaaatagtcagaattatatgggaatcttga

DBGET integrated database retrieval system