KEGG   Tetrahymena thermophila: TTHERM_01068140Help
Entry
TTHERM_01068140   CDS       T01020                                 

Definition
Glycosyl hydrolase family 20, catalytic domain containing protein (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tet  Tetrahymena thermophila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tet00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:tet00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:tet00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tet00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 564 aa AA seqDB search
MQKSIIIAAILLVGLASALRIVPVPQNLQKGNFTFEVASIDSVEFQFKTSGRLNELSSVQ
QRILESQNEQNLRKFKSIAHEKLDERLSKLKVAQAKNGLKGANLVVKVFLNNTDTQYTSY
DNFKIDEAYEISINQNLTNIEFKCHGYVSFLRAIETFIQILIQSHQKTHFAFDFLPLSIN
DAPAFGHRGVMIDTSRHFLSLEAIKQTIRGLSISKFNVLHLHLTDSESFPFELFSYPEIT
AFGAYSPEEIYTQEELRELDAYSQTYGVILIPEIDSPAHTRSWSNPPNLQDIDACRDYPK
EQWGLFCNEPPCGQLDVTLEKARTVAADIMVETARIFSSEFLHLGGDEPNKHCWETKASI
AEYMKANNISNYNELQTFYRDFQKEVIEQNNLNKKRIFWLASNNVDVQTDDQAIMQFWGD
LDEYSYMLKVNNPVILSTYTYLYLDCGLGNTFGDNSWCDPYKTWKRIYSFDVTAGNLISR
ERNLGSEAAIWTETSTTDDFVQKLFPRVIALSLNLWNPEAKLADIELVKHLVAIKDSIRL
AGIPTGAVSSQYCELNVEHCFFEN
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtcaattattattgctgctattttgctcgtcggcttagccagcgctttgcgt
atagtacctgttcctcaaaatctttaaaagggaaacttcacctttgaagtagcctccatt
gattccgttgaattctagttcaaaacctctggtagattaaatgaactctcatctgtccaa
tagagaatcttagaatctcaaaatgaataaaatctcagaaaattcaaaagcatcgctcat
gaaaaattagacgaaagactctctaaattgaaagttgcctaagctaagaatggtttaaag
ggtgctaacttagttgtcaaggtattcttgaataacactgacacttagtacaccagctac
gataacttcaaaattgatgaagcctacgaaatctcaatcaatcaaaatttgaccaatatt
gaattcaagtgtcatggatacgtttctttcttgagagccatcgaaactttcatctaaatt
ttgatccaatctcatcaaaaaactcacttcgctttcgatttcttgcctttgagcattaat
gatgcccctgcttttggacatagaggtgttatgattgatacttcaagacacttccttagt
ttagaagcaattaaataaacaattcgtggtctttcaatctcaaaattcaacgttcttcac
ttgcacttgactgattctgaaagtttccccttcgaattgttttcatatcctgaaatcact
gcctttggtgcctacagtcctgaagaaatttacactcaagaagaacttagagaactcgat
gcttattctcaaacctatggtgtcattctcattcctgaaattgactctcctgcccatact
cgttcctggtctaaccctcccaatctctaagatattgatgcctgcagagactatcctaaa
gaataatggggattattctgtaatgaacctccttgtggtcaattagacgttactttagaa
aaagcccgtacagttgcagctgatatcatggttgaaactgctagaattttctccagtgaa
ttcttgcacttgggtggtgatgaacctaacaagcactgctgggaaactaaggcttccatt
gctgaatacatgaaagctaacaatatctctaactacaatgaactctaaaccttctacaga
gatttccaaaaagaagtaattgaataaaataacttaaacaagaagagaatcttctggctc
gcaagcaacaatgttgatgtctaaactgacgattaagccatcatgtaattctggggtgat
cttgatgaatactcttacatgcttaaggttaacaatcccgttattctctctacctacact
tacctttatctcgactgtggtttgggaaatacctttggtgataactcttggtgtgatcct
tacaagacttggaagagaatctactctttcgatgttactgcaggtaatttgattagcaga
gaaagaaatcttggatctgaagctgctatttggactgaaacctctacaactgatgatttt
gttcaaaagctcttccctcgtgtcattgctctcagtcttaacctttggaaccctgaagct
aagcttgctgatattgaattagttaagcatttagttgctatcaaggactcaatcagacta
gctggtatccctaccggtgctgtctccagtcaatactgtgaactcaatgttgaacactgc
ttctttgaaaattga

DBGET integrated database retrieval system