KEGG   Tetrahymena thermophila: TTHERM_01128610Help
Entry
TTHERM_01128610   CDS       T01020                                 

Definition
Eukaryotic aspartyl protease family protein (EC:3.4.23.34)
Orthology
K01382  
cathepsin E [EC:3.4.23.34]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.34  cathepsin E
     TTHERM_01128610
Peptidases [BR:tet01002]
 Aspartic Peptidases
  Family A1: pepsin family
   TTHERM_01128610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 425 aa AA seqDB search
MFFYIKMNAMRFAYLLLALIVLQYSYCNIVKIPIKKKIIVDNENQAIDPLVNFNNFMYAG
EIEVGKNKQKFSVDFDSGSNLLWLTSKNCPTCRQAGYNNYYDCNTSDECEITNNYTQVAY
GDGSSVGGFIANVPVGIDGLGQVINSLLLVQETKNSDNLKSDGLMGLGIYDSSNKDNVSF
VSKLYQQGLIDKEEFSFYLDFDQNGSELVFGGFDETKVADPSQVFYHPVLLNGQQNSSQR
WVFSLKSVSIGEDNMELQKEANFAIVDSGTSLIAIRNDYFSDFIGILRQNFEISTIYAGT
RFYRVQCGTKLPDLTFTITDSQGVDRNYSIPSEFYVINVSGICVIGVQPLMEMDIQFILG
DVFMRRFVSIFSYQDKTVGLAQSVSTPPNSNQYIKEQNNLIIRLTLISAAIIIVFGLLYK
FKNSF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtttttttacataaaaatgaatgctatgaggtttgcatacttactattggctcttatt
gttttacaatattcttattgtaatattgtaaaaatacctattaaaaagaaaattattgtt
gataacgaaaactaagctatagatcctttagttaattttaacaactttatgtatgcagga
gaaatagaagttggaaaaaataagcaaaagttttctgtagatttcgactcaggatcaaat
ttgctttggttaacaagcaaaaattgtcccacttgcaggtaagcaggatacaacaactat
tacgattgtaatactagtgatgaatgtgaaataactaacaattatacataagtagcttat
ggagatggatcttcagtaggaggttttattgctaatgttcctgtaggcatagatggatta
ggtcaagttattaattctctcttacttgtttaagaaacaaaaaatagtgataatttaaag
tctgatggtttgatgggtttaggaatttatgattcatcaaataaagataatgtttcattt
gtaagcaagctatattaatagggccttatagataaggaggagtttagcttttatctagat
tttgattaaaatgggtctgaactagtttttggaggttttgatgaaactaaggttgctgac
ccttcataagttttttatcacccagttttattaaacggataacaaaattccagttagaga
tgggtattttctctaaagtctgtatcaatcggagaagataacatggagttatagaaagaa
gccaattttgcaattgttgactctggtacatcattgattgcaataagaaacgactacttt
agtgattttataggtattttaagataaaatttcgagatatctacaatttatgctggtact
agattttatagagtgtaatgtggtacaaaattacctgatcttacctttacaattaccgat
agctaaggagtcgatagaaactattctataccttctgaattttatgtaattaatgttagt
ggaatttgcgtaataggagtttaacctctcatggaaatggatatttaattcattttagga
gatgttttcatgaggagatttgtttcaattttctcttactaagacaaaactgttgggttg
gcttagtctgtttccacacctccaaattctaattagtatataaaagagtaaaataatctt
attataagattaactttaatctctgctgcaataatcattgtatttggattattatataaa
tttaaaaatagtttttga

DBGET integrated database retrieval system