KEGG   Tetrahymena thermophila: TTHERM_01141570Help
Entry
TTHERM_01141570   CDS       T01020                                 

Definition
isocitrate lyase family protein (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tet  Tetrahymena thermophila
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHERM_01141570
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TTHERM_01141570
Enzymes [BR:tet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TTHERM_01141570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 568 aa AA seqDB search
MNIKLLYPTPSQHEIFVLATSNRCEKVHSSTISISYDELVKMKERYVDLYVFGSAHPINQ
IKQTKMDVEGKRLQEITAEIQKWWTNSRWENVERPYQAQDVARLRPTIPMDYPSNYQSKK
MWKLLKEAQANKGFHHTFGALDPVQVINLSKYLRTVYVSGWQCSATASTTNEPGPDFADY
PANTVPNKVDQLFKAQLLQDRIQNEQRAHLTPEQRAKTPRVDYLAPMIADADAGFGGITS
TMKLIKLFIEAGAAGIHLEDQRPGTKKCGHMSGKVVVSTREHVNRLIACRLQADIMGTDL
IILARTDALSARLIDSNCDPVDHPFILGLCPDGKERTFPNAGLEAIKAKFTGAKVQEVTK
LWLSKCYDLSLTQAHEYARTLGFDFQFDWEALRSSEGFYSIDGCVELCAARAKQYLRYAD
MVWMETPTPSLEVATKFSTLVKNNHPTKLLAYNLSPSFNWSAFNMSNAQIQSFCADLGRL
GYTWQFITLAGFHLNALKSEKLSKDLAARGMLAYVETVQRKEEKHKVDQLTHQKWSGANY
VDACQALVQPESQTLASSKDSTENQFKH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaagctcctttatcctactccttcttaacatgagatattcgtcctagccact
tctaacagatgtgaaaaggtgcattcttcaacaattagtatctcatatgatgagttggtt
aaaatgaaggaaagatacgttgatttatatgtttttgggagcgcccatcctataaaccaa
atcaaacaaactaaaatggacgttgaaggaaagagactctaagaaatcactgctgaaatc
caaaaatggtggactaactctcgttgggaaaatgttgaaagaccctactaagcttaagat
gttgcccgtttaagacccaccatccccatggactacccctccaactactaatccaagaag
atgtggaaactcttgaaggaagcccaagccaacaagggattccaccacactttcggtgcc
ttagaccccgttcaagttatcaacttatccaagtacttgagaactgtctacgtctctgga
tggtaatgctctgccactgcctccactactaatgaacctggtccagattttgctgattac
cctgccaacactgtccccaacaaagttgaccaactcttcaaggcttaacttttacaagac
agaatccaaaatgaacaaagagctcatttgacccctgaataaagagctaagactcccaga
gttgactaccttgctcctatgattgctgatgctgatgctggtttcggtggtattacttca
accatgaagttaattaagttattcattgaagctggtgctgctggtatccatcttgaagat
taaagacctggtaccaagaaatgtggtcacatgagtggtaaggtcgttgtctccactcgc
gaacacgtcaacagattaattgcttgcagactccaagctgatattatgggaactgattta
attatcctcgccagaactgatgctttatctgctagacttattgactccaactgtgacccc
gttgaccaccccttcatccttggtctttgccctgatggtaaggaaagaactttccctaat
gcaggtcttgaagctatcaaggctaagttcactggtgctaaggtccaagaagtcaccaag
ctctggctctctaagtgttacgatctttccctcactcaagcccacgaatacgctagaact
ctcggttttgacttccaattcgactgggaagctctccgttcatctgaaggtttctactcc
attgacggttgtgttgaattatgtgctgctcgtgctaagtaatatttaagatatgctgat
atggtttggatggaaactcctactccctctttggaagttgctactaagttctctaccttg
gtaaagaataaccatcccaccaaattattggcttacaacctttccccctctttcaactgg
tctgctttcaacatgtccaatgctcaaatccaatctttctgtgctgaccttggtagactc
ggatacacctggtaattcattactttagctggtttccacttgaatgctctcaagtctgaa
aagctctctaaggatcttgctgcccgtggtatgctcgcctacgtcgaaactgtccaaaga
aaggaagaaaagcacaaagtcgaccaactcacccaccaaaaatggtctggtgctaactac
gttgatgcttgccaagcccttgttcaacccgaatctcaaaccttagcctcctccaaagac
tctactgaaaactaattcaagcattga

DBGET integrated database retrieval system