KEGG   Tetrahymena thermophila: TTHERM_01181990Help
Entry
TTHERM_01181990   CDS       T01020                                 

Definition
Melibiase family protein (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tet  Tetrahymena thermophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TTHERM_01181990
  Lipid metabolism
   00561 Glycerolipid metabolism
    TTHERM_01181990
   00600 Sphingolipid metabolism
    TTHERM_01181990
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    TTHERM_01181990
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TTHERM_01181990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 382 aa AA seqDB search
MRQTLQVFLVLFSTFAIINCLNNGLALTPAMGWNSWNHFHCDINEDLIKQTADAIVSSGL
ADAGYKYVNLDDCWQISRDSEGYIQEDKAKFPSGIKALADYVHSKGLKFGLYSDAGDFTC
EHRPGSLGYEVKDAERYAEWGVDYLKYDNCYNNNIPPQVRYPPMRDALNSTGHPIYFSMC
EWGEQDPATWAPEVGNSWRTTGDISDNYDSFLSILEQQVGLEKYAHRGAWNDPDMLEVGN
GGMTTQEYEAHFALWALLKAPLLIGCDVNNMSPDTFRILSNQEIIAINQDPLGIQGRRVL
KTDQYQLWIGTIVDGIAVILFNTSSQDSDLSFTFEQIGITGQAIIRDLYKHQDLGKFSNS
FSTNVPTHGVAVLKVVPLSFAY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagatagacattgtaagtctttttagttttattttcaacttttgcaattattaattgt
cttaataatggcctcgctttaacacctgctatgggttggaattcatggaaccactttcat
tgtgatattaatgaagacttgatcaaatagacagcagatgctattgttagctcaggatta
gctgatgcaggatataaatatgtcaatcttgatgattgctggcaaatttcaagagattct
gaaggatacattcaagaagataaagctaaattcccttcaggaataaaggcattggctgat
tatgttcatagcaaaggcttgaaattcggtctttatagtgatgctggtgacttcacttgt
gaacacagacctggctctcttggctacgaagtgaaagatgctgagagatatgcagaatgg
ggagttgactacttgaagtacgataattgctacaataataatattcctcctcaagtcaga
tatcctcctatgagagatgcccttaattctactggtcatcctatttatttctctatgtgt
gaatggggagaataagatcccgcaacttgggcccctgaagttggaaattcatggagaaca
actggagatatctcagataactatgattccttcctaagcattcttgaataacaagttggt
ttagagaagtatgcccatcgcggtgcttggaatgatccagatatgcttgaagttggtaat
ggaggtatgactacttaagaatatgaagctcattttgctctttgggctttattaaaagct
cctcttttgattggatgtgatgtaaataacatgtcccctgatacctttagaattctttct
aattaagaaataatcgcaattaactaagatcctctaggaatttaaggaagaagagttttg
aagacagattaatattaactctggattggcacaatagtagatggtatagcagttatcctc
ttcaacacttcttcctaagatagtgacttatcctttaccttcgagcaaattggtattaca
ggataagctatcatcagagatttatacaagcactaagacttaggaaagttttcaaattct
ttctcaacaaatgtacccactcatggagttgctgtacttaaagttgtccctctttcattt
gcttattga

DBGET integrated database retrieval system