KEGG   Tetrahymena thermophila: TTHERM_01205390Help
Entry
TTHERM_01205390   CDS       T01020                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase family protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1345 aa AA seqDB search
MKYQQTKIAIKNVNWAHTLILLIRTNVQLVQLINNQQNLISQIVQNKCSTCPADKQLVKS
DFTDCASSCLADEVLIDKNCYKKCELGSYFDSTNKNKCTACPADKQLVKSDFTDCASSCL
ADEVLIDKNCYKKCELGSYFDSTNKNKCSTCPADKQLVKSDFTDCASSCLADEVLIDKNC
YKKCELGSYFDSTNKNKCSTCPADKQLVKSDFTDCASSCLADEVLIDKNCYKKCELGSYF
DSTNKNKCTTCPADKQLVKSDLTDCASSCLADEVLIDKNCYKKCELGSYFDSTNKNKCST
CPADKQLVKSDFTGCASSCLADEVLIDKNCYKKCELGSYFDSTNKNKCSTCPADKSLVKS
DFTGCVSNCLADEVLIDKNCYKKCELGSYFDSTNKNLCTACPAGKQLVTSDFTGCASSCL
TDEVQIGKNCYKKCEIGSYFDSTNKNKCSTCPADKQLVKSDFTGCVSSCLADEVPIDKNC
YKKCELGLYFDSTNKNQCKTCPADKQLVKSDFTGCASSCLADEVQIGKNCYKKCELAQYF
DSTNKNQCKTCPADKQLVKSDFTGCASSCLADEVLIDKNCYKKCELGSYFDSTNKNQCKT
CPADKSLVKSDFQGCASSCLADEVQINKNCYKKCDDGQYFNSKDNNKCTICKLLITSDLL
DCKLQCSSQEIQIGTICYKKCQSGYYLQQNKICNICSQIVSSDGQKCVKQCNNGEILSLD
GKACLLQCPSDQFIDQQSQQCVTSCSKSLVISVDGKSCIQKCDVSQYLDQKTNQCNVCDQ
LVSSDGLSCVKKCKSNETISLKTKKCIGKCPNGQYLSQDESGCTNTCSNFVSSNGLLCVE
TCQKYEQQEQVNNQNFCKVCKNYFEIDQSSTPNQVKCLNNCGQNQMIYKFTDQSKDYKQC
VDKNFCQSKKQSSEYNNVCTDKCQYPDIDNQSQQCTLSCKQGTFYQAEDNSCQQKCNQYV
SSDQKLCIKSCSEIFEVLDNDNQCKKCSENEQLIIVNKQLTCRVIQNSSAEDLSNFKQSI
VEVIGNGVNTDQGLQQAKKQISSYVSATIDSVIKEISNKSEISSQDKAQVKTAINEIFSI
HKQLVTNVKNLPNEQSISTGSQQLKVSGQASKPGYKFSKTLSSSNIQSGNSQSLLEEDPN
STDTDSSQILQVAFVSTNIYCQNGNCKSNQPLYLLNLQDLNQSLLRVLQQTQSFNINFDI
NQNLDPNRYVCQSFDEQGNVSNSSGTIINNQIQCQITSSSSLFYDENCQIVDAKHCNQSE
DDDDGLSAAQIVGIAVSCFAFVGLTSVCIVSYIRSKYPAKQPIKVEQNYMITENDLLTQQ
NPKQTEQQSPYKKDEIVSLNQVVIQ
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactaatagacaaaaattgctataaaaaatgtgaattgggctcatactttgatt
ctactaataagaacaaatgttcaacttgtccagctgataaataattagtaaaatctgatt
tcacagattgtgcaaaacaaatgttcaacttgtccagctgataaataattagtaaaatct
gatttcacagattgtgcaagtagttgtctagcagatgaagtactaatagacaaaaattgc
tataaaaaatgtgaattgggctcatacttcgattctacaaataagaacaaatgcacagct
tgtccagctgataaataattagtaaaatctgatttcacagattgtgcaagtagttgtcta
gctgatgaagtactaatagacaaaaattgctataaaaaatgtgaattgggctcatacttt
gattctacaaataagaacaaatgttcaacttgtccagctgataaataattagtaaaatct
gatttcacagattgtgcaagtagttgtctagctgatgaagtactaatagacaaaaattgc
tataaaaaatgtgaattgggctcatactttgattctactaataagaacaaatgttcaact
tgtccagctgataaataattagtaaaatctgatttcacagattgtgcaagtagttgtcta
gctgatgaagtactaatagacaaaaattgctataaaaaatgtgaattgggctcatacttc
gattctacaaataagaacaaatgtacaacttgtccagctgataaataattagtaaaatct
gatttaacagattgtgcaagtagttgtctagcagatgaagtactaatagacaaaaattgc
tataaaaaatgtgaattgggctcatacttcgattctacaaataagaacaaatgttcaact
tgtccagctgataaataattagtaaaatctgatttcacaggttgtgcaagtagttgtcta
gcagatgaagtactaatagacaaaaattgctataaaaaatgtgaattgggctcatacttc
gattctacaaataagaacaaatgttcaacttgtccagctgataaatcattagttaaatct
gatttcacaggttgtgtaagtaattgtctagctgatgaagtactaatagacaaaaattgc
tataaaaaatgtgaattgggttcatacttcgattcaacaaataagaacttatgcacagct
tgtccagctggtaaataattagtaacatctgatttcacaggttgtgcaagtagttgtcta
accgatgaagtataaataggtaaaaattgctataaaaaatgtgaaataggctcatacttt
gattctacaaataagaacaaatgttcaacttgtccagctgataaataattagtaaaatct
gatttcacaggttgtgtaagtagttgtttagccgatgaagtaccaatagacaaaaactgc
tataaaaaatgtgaattgggcttatacttcgattctacaaataaaaactaatgtaaaact
tgtccagctgataaataattagtaaaatctgattttacaggttgtgcaagtagttgttta
gccgatgaagtataaataggtaaaaattgctataaaaaatgtgaattagcctaatacttc
gactctacaaataaaaactagtgtaaaacttgtccagctgataaataattagtaaaatct
gatttcacaggttgtgcaagtagttgtctagcagatgaagtactaatagacaaaaattgc
tataaaaaatgtgaattgggctcatactttgattctacaaataagaactaatgtaaaact
tgtccagctgataaatctttagtaaaatctgatttttaaggctgtgctagtagttgttta
gctgatgaagtataaataaacaaaaattgctataaaaaatgtgatgacggctaatatttt
aattctaaagataataataaatgcacaatttgtaagcttttaataacttcagatttatta
gattgtaagttataatgtagttcttaagaaatataaataggtaccatatgctataaaaaa
tgttaatcaggttattatttataataaaataaaatctgtaatatttgtagttaaatagta
agctctgatggataaaaatgtgttaaataatgcaataacggagaaattttgagcttagat
ggtaaagcttgcttattataatgtccttctgactaattcatagattaataaagctaatag
tgtgtaactagctgttcaaaatctttagtcattagtgtagatggaaagtcatgcattcaa
aaatgtgatgtaagttaatatttagatcaaaaaaccaattaatgcaatgtatgcgattaa
ttagtcagctctgatggtttaagctgtgttaaaaaatgtaaatctaacgaaacaattagc
ttaaaaactaaaaaatgcataggtaaatgtccaaatggctaatatttatcataagatgaa
tctggttgcacaaatacttgctcgaatttcgtatcaagtaacggattattatgtgttgaa
acctgctaaaaatatgagtaacaggaataagtaaataatcaaaatttttgcaaagtatgt
aaaaattattttgaaatagattaaagcagcacacctaattaggttaaatgcttaaataat
tgtggttaaaatcaaatgatatataaatttactgatcaatcaaaagattataaataatgt
gttgacaaaaatttttgttagagtaaaaaatagtcttcagaatataataatgtatgcaca
gataaatgctaatatcctgacattgacaactaatcatagtaatgcactctcagttgcaaa
caaggcacattttattaagctgaagataatagttgtcagtaaaaatgcaatcaatatgta
tcatctgattaaaaattatgtataaaatcatgttctgaaatatttgaagttttagataat
gacaactaatgcaaaaaatgctcagagaatgaataactgataattgttaataaataacta
acatgtagagttatttaaaactcctcagcagaagatttaagtaatttcaagtaatctatt
gttgaagtaattggtaatggtgttaatacagatcaaggtctttagtaagctaaaaaacaa
ataagttcttatgtttcagctactatagatagcgtgataaaagaaatatctaataaatca
gaaatttctagttaagataaggcttaagttaaaacagcgattaatgaaatattctcaata
cataagtagttagttactaatgttaaaaatttaccaaacgaacaaagtatttcaactggt
tcatagtaattaaaagtttcaggttaggctagtaagccaggctataagtttagtaaaaca
cttagttcatcaaacatttaaagtggaaattctcaatctttgttagaagaagacccaaat
tcaactgatacagattcatcataaatactataagttgcctttgttagcacaaatatatac
tgctaaaatggcaattgtaaatcaaatcaacccctttatttactgaatttgcaagacctt
aattaatcactattaagagtacttcaataaacttagagttttaatattaattttgacata
aatcaaaacttagatccaaacagatatgtctgctaaagttttgacgaataaggaaatgta
tcaaatagctcaggcactattattaataattaaatataatgttagattacttctagttca
tcattattttatgatgaaaattgttaaattgttgatgcaaagcactgtaattaaagtgaa
gatgatgatgatggattatctgcagcttaaattgttggaatagctgtatcctgttttgcc
tttgtgggattaaccagtgtgtgtattgtttcatatatcagatcaaaatatcctgctaaa
taacctataaaagttgagtagaattatatgattacagaaaatgatctacttacataataa
aacccaaaataaacagagtaacaatctccatataaaaaagatgaaattgtatctttaaat
taagtggttattcagtga

DBGET integrated database retrieval system