KEGG   Tetrahymena thermophila: TTHERM_01217200Help
Entry
TTHERM_01217200   CDS       T01020                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
tet  Tetrahymena thermophila
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TTHERM_01217200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 372 aa AA seqDB search
MNQPQQQQQDASLQDIQINNPQHLPQDTVSDIQFNPQNPQMFACSTWDGKIHIYQIAVQQ
NFNQIVGQFQQVSQMQYNEPITCIAWRGDGQAIYAGCGDNSVVLFNLSNGQSAKIGQHQA
GIRSIFYVQQLNGAVITCSFDTTVCFWSEQNPNNPLAKIQLKGKIFAADCLFPILALGLQ
GEVITFINLQSNFQNLSPHQINYIDSPLGKGSQINSIKIMCKGNGFGLGSIDGRANLGKL
TPQNQNNVAGYKIDNIMTFKCHKNEEKQNNVVNQILYPVNSICFNPRQDQFLLTCGSDGN
MYFWDFEHKNKIKSFAFNKQPISACNVSSTGQFLAYSLGYDWHMGYEHSNSFEKPKICVH
IINDDELRFRKN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaactagccttagcaataataataggatgcctctttgcaagatattcaaattaacaat
ccctagcacttgccttaagacactgtatctgacattcaattcaatccttaaaatccctaa
atgtttgcttgttcgacttgggatggcaagattcacatttattaaatcgcagtctaacaa
aatttcaactaaatagttggataattctaataagttagttagatgcaatacaacgagcct
attacctgcattgcatggagaggtgatggataagctatctatgcaggttgtggtgataat
tcagttgtactctttaatttaagtaatggataaagtgctaaaataggacaacattaagca
ggtattagatctattttctacgtctaataattaaatggagctgtaattacttgttctttt
gacactactgtttgcttctggtcagaataaaatcctaataatcctttggctaaaatataa
ttgaagggaaaaattttcgctgctgattgcttattcccaattttggcattaggcttgtag
ggcgaagtgattacttttatcaatttgtaatcaaatttctaaaatcttagtcctcattaa
attaattacatagattctcctcttggaaagggaagttaaataaatagcattaaaattatg
tgcaaaggtaatggttttggtcttggctctattgatggaagagcaaatcttggcaaactt
actccctaaaactaaaataatgttgcaggatataagatcgataacattatgaccttcaaa
tgtcataaaaatgaagaaaagcaaaacaacgttgtaaaccaaatattatatccagtaaac
tctatttgctttaaccctcgtcaagattaatttttattgacctgtggctcagatggcaat
atgtatttctgggatttcgagcacaaaaataagattaaatcctttgccttcaacaaacaa
cctattagtgcttgcaacgtctcttcaaccggacaattccttgcatattctcttggttat
gattggcatatgggatacgaacactctaactcattcgaaaagcctaaaatctgtgttcac
attataaatgacgatgaattaagatttaggaaaaattga

DBGET integrated database retrieval system