KEGG   Tetrahymena thermophila: TTHERM_01243480Help
Entry
TTHERM_01243480   CDS       T01020                                 

Definition
Lysozyme family protein (EC:3.2.1.17)
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 228 aa AA seqDB search
MKFFAKLIILSVVASAVFCNFGIDIATLFNNYQCFVDNGYDLAIIRAYRSLGLVDANANT
NLLNARAAGMDTDVYMFPCINDSKITAEQQVDDMINNLSLISSEDEGDAYDTIWVDVETN
PSTTCSWNNISSVQDRCNYLQRIVNQILYRGKKVGIYASHYMWVQIFGDDKNCQNFNQLP
LWYARYNNVTSTSDYSQYPFGGWTSAYAKQYAGSVSLCNVTVDLDYYN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttgcaaaattaattatattaagtgttgttgctagtgcagtattttgcaat
tttggcatagatatagccaccttatttaacaattattaatgttttgttgataatggttat
gatttagctatcattagagcatatcgctctcttggtttagtagatgcaaatgctaatact
aatctgctcaatgccagagctgctggaatggacacagatgtttatatgttcccttgtatt
aatgactctaaaattactgctgaatagcaagttgatgacatgatcaataacctttccttg
atctctagcgaagatgaaggagatgcttatgatacaatttgggttgatgttgagacaaat
ccttcaactacctgctcatggaataacatctcttcagtttaagatagatgcaactattta
caaagaattgtaaattagattttatatagaggaaagaaagtaggtatttatgcctctcat
tatatgtgggtataaatttttggtgatgataaaaattgttaaaatttcaactaattgcct
ctttggtatgcaagatacaacaatgttacaagtacatctgactattcttaatatccattt
ggtggttggacttcagcttatgccaagcagtatgctggttcagttagtttatgcaatgtt
actgtagatttagactactataattga

DBGET integrated database retrieval system