KEGG   Tetrahymena thermophila: TTHERM_01250150Help
Entry
TTHERM_01250150   CDS       T01020                                 

Definition
Lysozyme family protein (EC:3.2.1.17)
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 240 aa AA seqDB search
MNKIILLTLVVLSLLLATEARFEEPFFGFTQNQPLEEEEFQCLRDTTYYFIQTITGNDPQ
TVYQARMASFSGLDTQLIYIPCINKDTDSYPESRVTDQVKTFLKTVHQVSCQVIWIQISV
NDDEKCKWTDDIDFNCQRTKEIANYLKATANKNIGFFSSQEDWIKIFGSSEGCSSVSDKK
NFYPLYYKHLDGQPNTHDYKDHKFGSFENPAMKMYLSTEECNIKFNANVYYPQYLHIYDY
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaataatcttactaactttggtagtcctttctctattgttggcgactgaagcc
agattcgaagaacctttctttggattcactcaaaattaaccacttgaagaagaagaattt
taatgcttaagagatactacttattattttatccaaactattactggtaatgatcctcaa
actgtttactaagctagaatggctagtttttctggcttagacactcaacttatctacatc
ccatgcattaataaagatactgatagctatccagaaagcagagttactgattaagtaaag
acattcttgaaaaccgttcattaagtctcatgctaagttatttggatttaaatttcagtt
aatgatgacgaaaaatgtaaatggactgatgatatcgatttcaattgctaaagaactaaa
gagattgctaactatttaaaagctactgctaataagaatattggtttcttttcttcctaa
gaagactggattaaaatttttggaagtagcgaaggttgttcttcagtatcagataaaaaa
aatttctaccctctctactataagcatttagacggttaacctaatactcacgattacaaa
gatcacaaatttggaagttttgaaaatccagccatgaaaatgtatttatcaactgaagaa
tgcaatattaaattcaatgctaatgtttactatccataatatttacatatatatgactac
tga

DBGET integrated database retrieval system