KEGG   Tetrahymena thermophila: TTHERM_01289070Help
Entry
TTHERM_01289070   CDS       T01020                                 

Definition
(RefSeq) ubiquitin carboxy-terminal hydrolase
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 876 aa AA seqDB search
MYQSKINTNTAGEPQFTPEDHFASQYNAQEDRKIQEEVILKFYKFFKTAYEKSRIVYQIS
ISPLRQFKYYNFQLVYNLITSDNIHQSEIRKLFNVKFFQDLVENCEQLEVIGLALKLNCV
ITIPWLTNQSIQREYQQFKDEVTQFLDQKIENLASVNELDNYFLTNILQQLVEQKYNQQI
TQKIKSQDVKDTNNKIQTIIEEILLFNPTRLYSISNYLVIILIKYMLILPSITDSEIKLV
QKLNQLIFQRALSSQEGEQNYDVSKLTDILLFIFKSMKIPWDSKDPIRPNQNLHVLVEQL
AQGDLLYKYFESYSFDLIYVFFNPEDTVIILNNLIDCGYTQDICFLIFNIIRSLSQIRRF
DVIKYVHNEFIMKKIISKIQCKNCLRQTVGLIKETLFGLAKTVQLSDLQMQTLIKQLDFV
NHFKQAINREEISYLYKFFYLIYMNQDVTRGLSAQYAQKLKEIVKEGIDNKLIDINEQYI
RQKIEDMKNVYKMGDNIIEPSYQLSGLINVGNTCYINSFIHSLYHAQAFREFVLHYKTVF
DKSKVFCNFLDPVEEIMKVFFKMYSQPISMDIDAKQLKLSLPEPFRSSMEMQDSGEFGRM
YLDYIQNYLKDTNQNEEIDRFFFGKKENVIQCQQCKTNFRNTEKILDIYVNFCQQAYVKE
RQNYDLIQMIRSSFQAETFDENNAFYCDKCNKKTSAIKSALVKILPPYLTIYIGRFQYDK
QKQERIKLLYPTNLPQSFNIQDIFENTSIPQNQLQNFEYKLYAFIVHLGSQIDTGHYITY
GKDLEQPNSNWKLYDDNTVIEQIKSNADELVKNFAESETPYILFYANKNHKPIDLHRYIR
SKSQIYQNIDNLDLKQQISANGYFYNYNNNNNNNNN
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgtattaaagcaaaatcaatactaatactgctggagaaccataattcactccagaagac
cactttgcttcacaatataatgcacaggaagacaggaaaattcaagaagaagttatttta
aagttctataagttttttaaaacggcttacgagaagtctagaatagtgtatcagatatcc
atcagtccattaagataatttaagtactataatttccagttagtttataacctcattaca
agcgataatattcattaatcagaaataagaaagctcttcaatgtaaagtttttttaagat
ttggtagagaattgcgagtagttagaagtgattgggcttgcattaaaattaaattgtgta
ataacaataccatggctgaccaattaatcaatataaagggaatatcaataattcaaagat
gaagttacttaattcttagattagaaaatagagaatttagcaagtgttaatgagctggat
aattattttttaactaatattttatagtagttggttgagtagaaatataattagcagata
acacaaaaaattaagtcgtaagatgtaaaagacaccaataataaaatataaacaattatt
gaagaaatactgctttttaatcctaccagactttattctatttcaaattatctcgttata
atactaatcaaatacatgctaatccttccctctattacagattctgaaatcaagcttgtt
caaaagctcaattagctcatattctaaagagctctctctagttaagaaggagaataaaac
tatgacgtttcaaagttaactgacatacttttattcatttttaaatcaatgaaaatacct
tgggacagcaaagatcctattcgccctaattagaatcttcatgtgttagtagaacaacta
gcttaaggtgacttattatataagtactttgaatcctactcatttgacctaatatacgtt
ttcttcaatcctgaagacacagttattatacttaacaatttgattgactgtggatacact
caagatatatgctttttaatattcaacataatcaggtcactaagttaaattaggagattt
gatgttattaaatatgtccacaatgaatttatcatgaaaaaaattatttctaaaatataa
tgtaaaaactgtttaagatagacagtaggtttaatcaaagaaactctttttggtttagca
aagactgtttaattgtctgacttatagatgcaaacacttatcaaataattggatttcgtc
aatcattttaaataagcaatcaatagagaagaaatatcttatttgtataaattcttttac
ttaatttatatgaattaagatgttactagagggcttagtgcataatacgcgtaaaaacta
aaggaaatagttaaagaaggtattgacaacaagctaattgacataaatgaataatatata
aggcaaaaaatagaggatatgaaaaatgtatataaaatgggcgataatattattgaaccg
agttactaactatcaggtttaataaatgtaggaaatacctgctatattaattcattcata
cacagtctttatcatgcttaagcttttagagagtttgttttacactacaaaactgtgttt
gataagtcaaaagttttttgcaactttcttgatccagtggaggaaataatgaaggtattt
tttaaaatgtatagctaaccaatttctatggatatagatgccaaatagctaaaactttca
cttccagagcctttcagaagttctatggaaatgtaagactctggtgagttcgggaggatg
tatttggactatatataaaattatttaaaagacacaaattaaaatgaagaaattgacaga
tttttctttggtaaaaaggaaaatgtaatttaatgttaataatgtaaaacgaattttaga
aacactgaaaaaatacttgatatttatgtaaacttttgccagcaagcttatgtaaaagag
agataaaactatgatttgatttaaatgattagaagctctttttaggctgagacttttgac
gaaaacaacgctttttactgcgataaatgtaataaaaagacttcagctattaagtcagct
cttgttaaaatccttcctccttatttaactatttatattggcagattttaatatgataag
caaaaataagagagaattaagctgctttatcctaccaatcttcctcagtcttttaatata
taagatatttttgaaaacacttctataccacaaaatcaacttcaaaatttcgagtataaa
ttatatgcatttatcgtgcatttgggctctcaaattgacactggccattacatcacttac
ggtaaagatttagaataaccaaacagtaattggaaactctatgatgataacactgttatc
gaataaatcaaaagcaatgcagacgaattagttaaaaactttgctgagtcagaaacgcct
tatattttattctatgccaacaaaaatcataagcctatagatctgcacagatatattagg
tctaaaagttaaatatatcaaaatattgacaatttagatttaaagtaataaatatcagca
aacggctatttttacaattacaataacaacaataacaacaacaacaactga

DBGET integrated database retrieval system