KEGG   Tetrahymena thermophila: TTHERM_01369770Help
Entry
TTHERM_01369770   CDS       T01020                                 

Definition
(RefSeq) cytochrome P450 family monooxygenase
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: p450 SeleniumBinding
Motif
Other DBs
NCBI-GeneID: 7828507
NCBI-ProteinID: XP_001017055
TGD: TTHERM_01369770
UniProt: Q23JU9
AA seq 528 aa AA seqDB search
MIFLIYISLGIIASIIAFVSYILILYPIFRFSQMKRKYGDKVKVFFSIGQGILKFYNQDL
ANKNDSIAFIRNMHEPNLKAIAFNFGTKVGFSFVDPELQKQVLQNPHSYSKVDGPMAITF
LFANSIAYATEKEWKRQRLFLGKSFHFEEIKNYFPLIIETCQKTIKKIDQKLIERETINI
QILKTCQEITSEVSFKVFFGSNNENLTIITRKDGSSTTISNELVQVLIDSYYLFQTDKVA
LIKWILLKRKSTSFFLTKGEEQLLNRLKALRQACTAIVSKRKEELTQDRLLAKKNFLDQY
IIEMAQNENSGITYDEIIDNFSAIYLAGTDTTSNMAGVALYYLSLYPEIQQQAREEVIKV
LSVKLKENKTDQLFSLLAFEDLQNLNLINSILKESLRLMPPAIQSQTKFANQDIKIGEFD
VKKGDLVTNHFSYNLSNPEVFPNPDVFNPNRWMAANIHNEMANFTPFSQGPRNCIGQHLA
MIEGKCILASLLLQYEILPNPAEKVVRQMRIVYGFQYDNLVYFKKINV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcttatttatataagcttaggtataatagcttcaataattgcttttgtatca
tacatccttattttatatcctattttccgcttttctcaaatgaagcgaaaatatggtgat
aaagttaaagtcttctttagcattggacaaggaatacttaagttttacaaccaagatcta
gctaataaaaatgatagcattgcttttatccgtaatatgcatgaacctaatttaaaagcc
attgcttttaactttggaacaaaagtaggatttagctttgtagaccctgagctctaaaag
caggtactttaaaatcctcactcttatagtaaagtcgatggacctatggcaatcacattt
ttatttgctaattcaatcgcttacgcaacagagaaagaatggaaaagacaaagattgttc
ttaggaaagtcctttcactttgaagaaataaaaaactactttcctttgatcatagaaact
tgtcaaaaaacgataaaaaaaatagactaaaaattgattgagagagaaacaataaatatt
taaattttaaagacttgccaagaaattacttcagaagtgtcttttaaggttttttttggc
tcaaataatgaaaatttaacaattattactaggaaagatggaagctcaactaccatttct
aatgaacttgtttaagttctcattgattcatattatttattctaaactgataaagtagca
ctaattaaatggattttgcttaaaagaaaaagtactagctttttccttacaaaaggagaa
gaatagctgttgaatcgtttgaaagctttaagataagcatgcacagctattgtttcaaag
aggaaggaggagcttacctaagatagacttttagcaaagaaaaacttcttagattagtat
ataattgaaatggcttaaaacgaaaacagtggtatcacgtatgatgaaataattgataat
ttttctgcaatttacttagcaggtacagacacaactagtaatatggctggagttgcttta
tattatctctccctttatccagaaatttagtaacaagcaagagaggaagttattaaagtg
ctctcagttaaattaaaggagaataaaactgactaactcttcagtttattagcttttgaa
gatctccaaaatttaaatttgataaattctattttgaaagaatctttaagattaatgccc
ccagctatataatcatagacaaagtttgctaatcaagatataaaaattggggaatttgat
gttaaaaaaggggatttagttactaatcatttttcttataatttatcaaatcctgaagta
ttccctaacccagatgtctttaatcctaatagatggatggctgcaaatattcacaacgaa
atggcaaactttactcccttttcataagggccaaggaattgcattggttaacatcttgcg
atgatagaaggaaagtgcattctagcttcccttttattgtaatatgaaatactgccaaac
ccagctgaaaaagtagttaggcaaatgaggatagtatatggattttagtatgataatctt
gtttatttcaaaaaaataaatgtttga

DBGET integrated database retrieval system