KEGG   Tetrahymena thermophila: TTHERM_01435670Help
Entry
TTHERM_01435670   CDS       T01020                                 

Definition
Alpha amylase, catalytic domain containing protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tet  Tetrahymena thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTHERM_01435670
Enzymes [BR:tet01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TTHERM_01435670
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTHERM_01435670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 734 aa AA seqDB search
MYIDGADTIARKEGSRSYSKKKSTFAPHQQGFSLDSYPENIDEFQVFKDDPYLNDFKEHF
RVRNDAFRQQLTHILRAENSLEDFAKGYKRYGFNQEGDNLVYREWAPSAKEIYLTGDFNS
WNRKQYPLQKDAFGNWEIQIPFNSQGKPIIPHGSRIKAHVLTANNEWVDRIPVWSKRVIQ
DENSKLFDGQFWWPEKNYQFQHPRPHKHHALRIYETHIGMAGIEPRVHTFAEFTRDVLPR
IKDLGYNTIQIMAVAEHAYYGSFGYHVTNLFSVSSRFGTPEDLKNLVDTAHSMGIHVLMD
IVHSHASKNVNDGFNNWDGTDYQYFHEGAKGNHDLWDSKIYNYGKWEVLRLLLSNLEWFM
TEYMFDGFRFDGITSMLYKHHGMGVGFSGGYHEYFNHDAEIETLVYLMLANELVHEIYPD
AITIAEDVSGYPTLCRKVKEGGVGFDYRLQMAVPDKWIKLLKEKRDDDWDMEDLVWTLTN
RRSDEKCIVYAESHDQALVGDKTLSMWLFDAQIYENMSTLSHETLTVNRGIALHKMIRLI
TIALGGEGYLNFMGNEFGHPEWIDFPRQDNGWSYHHCRRRWDLVDDQLLRFRFFNNFDRD
MIHLESHFKWLNSRYNYVSTKNQGDKVIVFERDNLLFVFNFHPTQSFENYKIGTNIAEDH
LIIMDTDEPHYGGHDRVRAGHEKPFPYIQENFNGRPYCLNVYIPSRCAMVLTSVSQAHNY
WNQKKLLNEAKKHH
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtatattgacggtgctgacacaattgctagaaaggaaggatctcgttcttattccaaa
aagaaatctacattcgctcctcattagcaaggcttttccttggactcttaccctgaaaat
atagacgaattttaggttttcaaggatgacccctacttgaatgattttaaagagcatttc
agagtaagaaatgacgcctttagataatagctcactcacatcctccgtgctgaaaactcc
ctcgaggactttgctaaaggttataagagatatggattcaattaagaaggagataatctc
gtttacagagaatgggctccaagtgcaaaggaaatttacttgacaggagatttcaatagc
tggaatagaaagcaatacccattataaaaagatgcctttggtaattgggagatataaatt
cctttcaattcataaggaaagccaataatccctcatggatctcgtataaaagcacatgta
ttaactgctaataatgaatgggtagatcgtattccagtgtggagcaaacgtgtaatccaa
gacgaaaatagcaagctttttgatggacaattttggtggcctgagaaaaactattaattt
tagcatcctcgtcctcacaaacaccatgcattgagaatctatgagacacatatcggtatg
gctggaattgaacctcgtgtccatacttttgctgaattcactagggatgttttacctcgt
attaaagatcttggttacaacactatccaaattatggcagtagctgaacatgcctactat
ggatcctttggatatcacgtcacaaatctcttctccgtttcttcacgttttggaactcct
gaagatttaaaaaatttagttgacactgctcatagcatgggtattcatgttcttatggac
attgttcactctcatgcaagtaagaatgtcaatgatggtttcaataattgggacggaact
gattatcaatacttccacgaaggagctaaaggaaaccatgatttgtgggactcaaagatt
tacaattatggcaaatgggaagtgttaagattacttttaagtaatttggaatggttcatg
actgaatacatgtttgatggtttccgttttgatggtattacttctatgttatacaaacac
catggtatgggagtaggtttcagtggcggttatcatgaatattttaatcatgatgctgaa
atagaaaccttagtctacttaatgttggctaatgaacttgttcatgaaatttatcctgat
gctattactattgctgaagatgtttctggctatcccacactttgcagaaaagttaaagaa
ggtggtgttggtttcgattatagattacaaatggctgttcctgataaatggatcaagcta
cttaaagaaaagagagacgatgactgggatatggaagatcttgtatggactttaacaaac
agaagaagtgacgaaaaatgtattgtttatgctgaaagtcacgattaagccttagtcgga
gataaaactctttccatgtggctttttgatgcttaaatttatgaaaatatgagcactctt
tctcatgaaactctcacagtaaatagaggtattgctctccataagatgatcagattaata
acaattgcccttggaggagaaggttatcttaactttatgggtaacgaatttggtcaccca
gaatggattgatttccccagataagataatggctggagctatcatcattgtcgtagaaga
tgggacttagtagatgactaacttctcagattcagattctttaataatttcgatagagac
atgattcatcttgaaagtcatttcaagtggttaaactcaagatacaactatgtcagcacc
aaaaatcaaggagataaagttattgtttttgagagagataatcttcttttcgtatttaac
ttccatcctacacaaagcttcgaaaattataaaatcggtaccaacattgctgaagatcat
ttaattattatggatactgatgagcctcattacggtggtcatgatagagttagagctgga
catgaaaagcctttcccttatatttaagaaaactttaatggtagaccctattgcttaaac
gtgtatataccatcaagatgtgctatggttttaacatctgtaagctaagcacataattac
tggaactaaaaaaagttacttaatgaagccaaaaagcatcactga

DBGET integrated database retrieval system