KEGG   Tetrahymena thermophila: TTHERM_01698320Help
Entry
TTHERM_01698320   CDS       T01020                                 

Definition
(RefSeq) cytochrome P450 family monooxygenase
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 507 aa AA seqDB search
MAILELIGASLLAFIIFLVIKYYVLTKMAMRFYANQGIKEYKYYPVTGMAKEWMDYSSSD
NLKTIKYIKFDDKFKGEDAILSNLLDRALLIFTNPNLINEFLQNQQNYIKFEAPVVGFKQ
FLGNGIALEEGEKWKSKRKFISKLFKFDVVVNYLNSIRKISKMMLDRVENDSNFSVQKSF
EAINSAISVQIFMGANIDDYKIDGKNPYDAIDTMCFEIFQHYLNLIPGILGERFVKLKLR
KSDRIICEKVQYVRQQMKNIILDTIKREKSHAEQNKESENINIIALLIKEGHKLDEEKEI
IDILELTFSLYFASRDTLASVLTMMLYYLIKNPDYFKLVEKEVLSLPQNYSFSDIQKLDF
LQACFKETIRINTSAPILFTREAKVDHKIGNYNIQKGTYVNVGLISNQIDETYFKDPLTF
NPNRWLDHSAENMIKENPFVYLPFSGGMRNCIGQHLANLQAKIVLVEFVKKYQIPQMPND
FVLEFVIKQNYQIKNPLILNLTKRQAY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggctatattagagcttattggtgcttcgcttcttgcatttataatatttttagtaata
aaatattatgttttaactaaaatggctatgcgcttttatgctaattaaggaattaaagag
tacaaatactatccagttactggtatggctaaagaatggatggattattcatcgagtgat
aatttaaagactataaaatacattaaatttgatgataaatttaaaggagaagatgctata
ttgtctaatttactagatagagcacttttaatatttacaaatcccaatctgattaatgag
tttttataaaatcagtagaactacatcaagtttgaggctcctgtagttggatttaaataa
tttcttggaaatggtattgctttagaagaaggagaaaaatggaagagcaaaagaaaattt
atttctaagttatttaagtttgatgttgtagtaaattatttaaatagcattcgcaaaatt
tcaaaaatgatgcttgatagagtagaaaatgactcaaatttttcagtttaaaagtcgttt
gaagcaattaatagcgctatttctgtttaaatttttatgggcgctaacatagatgactat
aaaattgatggcaagaatccttacgatgcaattgacacaatgtgctttgaaattttttaa
cattatttgaatcttatccctggcatcttaggagagagatttgtgaagcttaaactcaga
aaatcagataggattatctgtgaaaaagtttaatatgtgcgctaatagatgaaaaacatt
attttagatactattaaaagagagaaatctcatgctgagtagaacaaagagtcagaaaat
attaatataattgctcttttaattaaagaaggacataaattggatgaagaaaaagaaatt
attgatatattagagcttacttttagcctttattttgcttcaagagacactttagcaagt
gttttaactatgatgttgtactatttaatcaaaaatcctgattactttaaattagtagaa
aaagaagttttgagtctaccctaaaattactcattttctgatatttaaaagttagatttt
ctttaggcctgtttcaaagaaacaatcagaataaatacaagtgcccctattttatttacc
cgtgaagctaaggttgaccataaaataggaaattataatatttaaaaaggtacttacgtt
aatgtgggtttgattagcaattaaattgatgaaacatacttcaaagaccctctaacattt
aacccaaacagatggcttgatcattctgctgaaaacatgatcaaagaaaatccgtttgtc
tatttgcctttctctggcggaatgagaaactgtataggtcagcatcttgcaaatttgcaa
gcaaaaattgtacttgttgaatttgtaaaaaaatattagattccacaaatgccaaatgat
ttcgttttggaatttgttattaaataaaattatcaaataaaaaatcctctaattttaaac
ctaactaaaagacaagcttattga

DBGET integrated database retrieval system