KEGG   Thermoanaerobacter sp. X514: Teth514_0103Help
Entry
Teth514_0103      CDS       T00648                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Teth514_0103
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Teth514_0103
Enzymes [BR:tex01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Teth514_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
99009..100259
Genome map
AA seq 416 aa AA seqDB search
MITTKFIVEKSPPLKGSVKISGAKNSVLPIIAASLLSSGEIVLDDIPTLEDVNVMIELIK
HFGAICEFENEKLKIKVDIKDVEAPYDLVKKMRASFLVMGPILARLGHAKISMPGGCAIG
SRPIDLHLKGFQTLGADITIGHGYVEARAKKLTGKKIYLDFPSVGATENIMMAAVFAEGV
TIIENAAEEPEIVDLANFLNKMGANIKGAGTDTIRIEGVKELKGAEHTVIPDRIEAGTFM
VAAAMTGGNVLIENVIVDHVRSIIAKLTECGIKITEEPKGLRVKGIKNYKAVDIKTLPYP
GFPTDMQAQMMVMMTVAKGTSVIIETVFENRFMHVDELKRMGANIKIEGRSAVVTGVDHL
TGAEVKATDLRAGAALVLAGLIAEGRTEINDIYHIDRGYVKMEEKLKNLGAIIYRI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgataacaacgaaatttattgttgaaaaaagcccacctcttaaaggaagtgtaaaaata
agtggtgctaaaaattctgtattacctataattgccgcttctttgttgtcatcaggagaa
atagtgttagatgacatacctactttagaggatgtcaatgtcatgatagagttaattaag
cattttggtgctatatgtgaatttgaaaatgagaaattaaagataaaagtggatattaaa
gatgtagaagccccatatgatttggtgaagaaaatgagagcatcgtttttggtgatggga
cccatacttgcaaggttggggcacgctaaaatttctatgccaggtgggtgcgctattggt
tctcgaccaatagatttgcatttaaaaggatttcaaactttgggagcagatatcaccata
ggacatggttatgtagaagcacgagccaaaaaattgacaggcaaaaaaatttatttagat
tttccaagtgttggggctacagaaaacatcatgatggcggcagtttttgcggaaggagtt
actataatagaaaacgctgcggaagagccggaaattgttgaccttgccaattttctcaac
aagatgggagcaaatattaaaggcgcggggacagatacaataagaattgaaggagtaaag
gagctaaaaggggctgagcatactgtcataccagatagaattgaagcagggacttttatg
gtagcagctgcaatgactggaggaaatgttcttatagaaaatgtcatagtggatcatgta
aggtctataattgcgaaattaacagaatgcggaattaagataacagaagaacctaaggga
ctgcgagtcaaaggaatcaaaaattataaagcagtggacataaaaactcttccttatcca
ggctttcctacagatatgcaagctcaaatgatggttatgatgacagtggcaaaagggaca
agcgttataatagaaacagtttttgaaaatagatttatgcatgtggatgagctaaagcgt
atgggggcaaatataaagatagaagggagaagcgctgttgttacaggagtagatcatttg
acaggtgcagaagttaaagcaacggatttaagggcgggagcagccttagtattggcagga
cttattgcagaaggtaggactgaaataaacgatatttatcatattgacagaggttatgta
aaaatggaagaaaagttaaaaaatcttggtgcaatcatatatagaatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system