KEGG   Thermoanaerobacter sp. X514: Teth514_0153Help
Entry
Teth514_0153      CDS       T00648                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Teth514_0153
   00051 Fructose and mannose metabolism
    Teth514_0153
Enzymes [BR:tex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Teth514_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
150618..151934
Genome map
AA seq 438 aa AA seqDB search
MEYFKNVPQIKYEGPKSNNPYAFKFYNPDEIIDGKPLKEHLRFSVAYWHTFTANGTDPFG
APTMQRPWDHFTDPMDIAKARVEAAFELFEKLDVPFFCFHDRDIAPEGETLRETNKNLDT
IVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGAATSCNADVFAYAAAQVKKALEITKELG
GQNYVFWGGREGYETLLNTDMELELDNLARFLHMAVEYAQEIGFEGQFLIEPKPKEPTKH
QYDFDAASVHAFLKKYDLDKYFKLNIEANHATLAGHDFQHELRYARINNILGSIDANMGD
MLLGWDTDQYPTDIRMTTLAMYEVIKMGGFNKGGLNFDAKVRRASFEPEDLFLGHIAGMD
AFAKGFKVAYKLVKDGVFDRFIEERYKSYREGIGAEIVSGKANFKTLEEYALNNPKIENK
SGKQELLESILNQYLFSE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcaaaaatgtaccacaaataaaatatgaaggaccaaaatcaaacaatcca
tatgcatttaaattttacaatccagatgaaataatagacggaaaacctttaaaagaacac
ttgcgtttttcagtagcgtactggcacacatttacagctaatgggacagatccatttgga
gcacctacaatgcaaaggccatgggaccattttactgaccctatggatattgccaaagcg
agagtagaagcagcctttgaactatttgaaaaactcgacgtaccatttttctgtttccat
gacagagatatagctccggaaggagagacattaagggagacgaacaaaaatttagataca
atagttgcaatgataaaagactacttaaagacgagcaaaacaaaagtattatggggtaca
gcgaaccttttttcaaatccgagatttgtacatggagcagctacttcctgtaatgcagat
gtatttgcatatgcagcagcgcaagtaaaaaaagcccttgagataacaaaagaacttgga
ggacagaactatgtattttggggtggaagagaaggatatgaaacattacttaacacagat
atggaattggaacttgataacttagcaagatttttgcacatggcagtagaatatgcacaa
gagataggatttgaagggcagtttttaattgagccaaaacctaaagaaccgacaaaacac
caatatgattttgatgcagcaagtgtacatgcatttttaaagaagtacgaccttgataaa
tacttcaaattaaacatagaagcgaaccatgcgacacttgcaggacatgactttcaacat
gaattaagatatgcaaggattaacaacatattaggctctatagatgcaaatatgggagat
atgcttttaggatgggatacagaccaatatccaacagacatacgaatgacaacccttgcg
atgtacgaagtcataaagatgggaggttttaacaaaggtggacttaacttcgatgcgaaa
gtaaggcgtgcctcctttgagccagaagatttatttttagggcatatagcgggtatggat
gcatttgcaaaaggattcaaagtagcctataagcttgttaaagatggtgtatttgataga
tttatagaagaaagatacaaaagttatcgagaaggcataggagcagagatagtaagtggg
aaagcgaattttaaaactcttgaagaatacgcattaaacaatccaaaaattgagaacaaa
tcaggcaagcaggaactactggagtcaatattaaatcagtatttatttagtgaatga

DBGET integrated database retrieval system