KEGG   Thermoanaerobacter sp. X514: Teth514_0162Help
Entry
Teth514_0162      CDS       T00648                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Teth514_0162
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Teth514_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
162683..163612
Genome map
AA seq 309 aa AA seqDB search
MEKIVVVGSINMDVVIRVPHIPVVGETVIAYDLKNYGGGKGANQAVSIARLGGTVFMIGR
VGNDEYGKKLYEDLKNDSVDIKGIEFDYEIPTGTAYINVSERGENNIVVYQGANKRLNIE
QIEKHEDIFDEAKMCVIQLEIPVETVEFVVDLCYRKGIKVILNPAPACELPDTLLEKVYI
LTPNETELALLSRSKTETIADIKKASKYLLDKGVQNVITTIGEKGSFFINKDTEKLFDAI
KVTAVDTTAAGDSFTGALAVALSEGKNIESAIEFATYVAALTVTKEGAQSSLPYRDEVEK
FIKERGYNK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatagttgttgttggaagtattaatatggacgttgtgatacgagttccgcat
attcctgtagttggtgagacagttattgcttatgatttaaaaaattacggcggtggtaaa
ggcgcaaatcaagcggtatcaattgcaaggttgggtggaacggtctttatgatcggcaga
gtgggaaatgatgaatatggtaagaaattatatgaggatttaaaaaatgatagcgttgac
attaaaggaatagaatttgattacgaaataccgacgggtacagcttatattaatgtgagt
gaaagaggagaaaataacatagttgtttatcagggagcaaataaaaggcttaatatagag
caaatagaaaaacacgaagatatttttgatgaagcaaaaatgtgtgtaattcagttagaa
ataccagttgagacagtagaatttgtagtggatttatgttaccgaaagggtataaaagtc
atattaaatcctgcaccagcatgtgaattgcctgatacgctcttagaaaaggtttatatt
ttaactccaaatgaaacagaattagctcttttatctagaagtaaaacagaaacaattgca
gatataaaaaaggcctcaaaatatttgctggacaaaggagttcaaaacgttataacaact
attggagaaaaaggaagcttttttatcaataaggatacagaaaaactatttgatgcgatc
aaagttactgctgttgatacaacagcagcaggtgattcatttacaggagcattagcagtg
gcattaagtgaagggaagaacattgaaagtgcaatagaatttgctacatacgtagcagca
ttaacggttactaaagaaggcgctcagtcatccttgccttatagagatgaggtagaaaaa
tttattaaagaaaggggttataacaaatga

DBGET integrated database retrieval system