KEGG   Thermoanaerobacter sp. X514: Teth514_0182Help
Entry
Teth514_0182      CDS       T00648                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Teth514_0182
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Teth514_0182
Enzymes [BR:tex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Teth514_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
184152..185714
Genome map
AA seq 520 aa AA seqDB search
MTLEEKIGQMLMVGFPSPTYDDHVEKLVSEYKIGNIILFSRNVKGKEQLQNLCNNIQMNI
IKHTGIPALVAIDQEGGMVTRIYKDATYLPGNMAIAATNEVENAYKIGEIAGKELRALGI
NINFAPVLDINNNLSNPVIGVRSYGENPEKVAEFGINYIKGLQKENVIATAKHFPGHGDT
SVDSHLDLPLVSYNKERLYRIELYPFKKAIENGVEAIMTAHILFSALEENKLPATLSHNI
LTNILRKELRFNGLIITDCMEMNAIAKYFGTAKAAAMAIKAGADIVLVSHTKKLQIEAFN
EIKEAVLRGEISIERIDESVERIIQLKEKYKLFENPYPDENKIKTIVGCKEHQEIAKNIS
LNSITIVKDENNLLPIRKQKILAVSPETVPISGVDDTLMDKVSFAKAFVQKFGGVEKTIP
VNPDEDLINTIREEAKDKEIVVVGAYNASLNEGQVRLVNSLLEVNKNIIVVALRNPYDLL
EFEDVPTYVCTYEYTPLSVESVLEVLSGNYVPKGELPVSL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacactggaagaaaagatagggcaaatgctgatggttggctttccgtcgcccacctat
gatgaccatgttgagaagttagttagtgaatataaaattggtaacataattttattttct
agaaatgtaaagggaaaagaacagcttcaaaatttatgcaataatatccagatgaacata
ataaaacatacaggcattccagcgttagttgctattgaccaggagggaggaatggttaca
agaatttataaagatgccacttatttaccaggcaatatggcaatagcagcgacaaatgaa
gtagaaaatgcatataagataggagaaatagcaggtaaagagcttagagcattgggcata
aatattaattttgctcctgtccttgatattaataataatctatctaatcctgtaataggg
gttaggtcttatggagaaaatccagaaaaagtagcggagttcggaattaattatataaaa
ggtttacaaaaagaaaatgttatagcgacagcgaagcattttcccggtcatggggatact
tcagtagattctcatcttgatttaccattggtgtcttacaataaagagcgattatataga
attgagttatatccttttaaaaaagcaatagaaaatggtgtggaagccataatgacagcc
catattctcttttcagctcttgaggaaaataaattgcctgcaacattgtcccataatatt
ctcaccaatatactgagaaaggaacttagatttaatggattaattataactgattgtatg
gaaatgaatgcaattgcaaaatattttggtacggccaaagcagctgcgatggccataaaa
gcaggagcagatatagtccttgtttcccatacgaaaaaactgcagatagaggcatttaat
gaaatcaaagaggcagttttacgaggtgaaatatcaattgaaagaatagatgaatctgtt
gaaagaataatccaattaaaagagaaatacaaactttttgaaaatccatatccagatgaa
aataaaattaaaactattgtggggtgtaaagaacatcaagaaattgcaaaaaacataagt
ttgaatagcatcactattgttaaagacgaaaataaccttttaccaataaggaaacaaaaa
atattggcagtttctcctgaaacagtcccaatttcaggtgtggatgatactttaatggat
aaagtatcttttgcaaaagcttttgtgcaaaaatttggaggggttgaaaaaactattcct
gtaaatcctgatgaagacctcataaatactatcagagaagaggctaaagataaagaaatt
gttgtagtaggcgcttataatgctagtttgaatgaaggccaagtaaggcttgtaaactca
ttgctggaagtgaataaaaatatcatcgttgttgccttaagaaatccatatgatttatta
gaatttgaagatgtgcctacatatgtttgtacttatgaatatactccactttctgtagaa
agtgtgctagaggttttaagtggtaattatgtgccaaaaggagaattgccggtttcttta
taa

DBGET integrated database retrieval system