KEGG   Thermoanaerobacter sp. X514: Teth514_0320Help
Entry
Teth514_0320      CDS       T00648                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Teth514_0320
Enzymes [BR:tex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Teth514_0320
Exosome [BR:tex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Teth514_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
335724..336698
Genome map
AA seq 324 aa AA seqDB search
MDLVKRPRRLRMNSILREMIRETSLDVGDLIYPLFVVPGDNIKEEIDSMPGVYHFSIDLL
VEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVREIKEKVPEIVVITDVCM
CGYTIHGHCGIVENGQVVNDKTIDYIAKIALSHVEAGADIVAPSDMMDGRVAAIRKLLDS
KGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMDYGNSNEALREIALDIEEG
ADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKAAAKMGWIDEKSVVLEILTS
IKRAGADIVITYFAKDVAKWFITL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtaaaaaggccaagaaggcttaggatgaacagtattttaagggagatgata
cgagaaacttctttagatgttggtgaccttatatatcctctttttgttgtgccaggagat
aatataaaagaagagatagattcaatgccgggtgtttaccatttttctatagatttgctt
gtagaagaagttaaagaagtgcgtgaccttggaattcctgctattttactttttggtgtg
ccttcatataaagatgaattagggtcagaggcttatagtgaggaaggcatcgttcaaaaa
gcggtgagagaaataaaagaaaaagtgcctgaaattgtggtaataacagatgtgtgtatg
tgtgggtatacaattcatggtcactgtggaattgttgaaaatggacaagttgtaaatgac
aaaacgatagattacatcgctaaaatagccttgtcccatgttgaggcaggggcggatatt
gtagcgccttctgacatgatggatggaagagtagctgccataagaaagcttttagatagt
aaaggatttgtaaacacacctattatggcttacagtgctaaatacgcttcctctttttat
ggaccttttagagaagcagcaaattctttcccacaatttggcgacagaaagtcttatcaa
atggactatggaaactccaacgaagccttaagagaaatagctcttgacattgaagaagga
gcagatattgtcatggtaaagccggcactttcttatcttgatattataaggcgggtaaag
gataatttcaacattcctattgctgcttataatgtaagtggagaatattcaatggtaaag
gcggcagctaagatgggttggattgatgaaaaatcggtagtcttagaaatactcacttca
attaaaagggcaggggcagacatagttataacctactttgcaaaggatgttgcaaaatgg
tttattaccctataa

DBGET integrated database retrieval system