KEGG   Thermoanaerobacter sp. X514: Teth514_0320Help
Entry
Teth514_0320      CDS       T00648                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
tex00860  Porphyrin and chlorophyll metabolism
tex01100  Metabolic pathways
tex01110  Biosynthesis of secondary metabolites
tex01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Teth514_0320
Enzymes [BR:tex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Teth514_0320
Exosome [BR:tex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Teth514_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABY91636
UniProt: B0K2L6
Position
335724..336698
Genome map
AA seq 324 aa AA seqDB search
MDLVKRPRRLRMNSILREMIRETSLDVGDLIYPLFVVPGDNIKEEIDSMPGVYHFSIDLL
VEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVREIKEKVPEIVVITDVCM
CGYTIHGHCGIVENGQVVNDKTIDYIAKIALSHVEAGADIVAPSDMMDGRVAAIRKLLDS
KGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMDYGNSNEALREIALDIEEG
ADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKAAAKMGWIDEKSVVLEILTS
IKRAGADIVITYFAKDVAKWFITL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtaaaaaggccaagaaggcttaggatgaacagtattttaagggagatgata
cgagaaacttctttagatgttggtgaccttatatatcctctttttgttgtgccaggagat
aatataaaagaagagatagattcaatgccgggtgtttaccatttttctatagatttgctt
gtagaagaagttaaagaagtgcgtgaccttggaattcctgctattttactttttggtgtg
ccttcatataaagatgaattagggtcagaggcttatagtgaggaaggcatcgttcaaaaa
gcggtgagagaaataaaagaaaaagtgcctgaaattgtggtaataacagatgtgtgtatg
tgtgggtatacaattcatggtcactgtggaattgttgaaaatggacaagttgtaaatgac
aaaacgatagattacatcgctaaaatagccttgtcccatgttgaggcaggggcggatatt
gtagcgccttctgacatgatggatggaagagtagctgccataagaaagcttttagatagt
aaaggatttgtaaacacacctattatggcttacagtgctaaatacgcttcctctttttat
ggaccttttagagaagcagcaaattctttcccacaatttggcgacagaaagtcttatcaa
atggactatggaaactccaacgaagccttaagagaaatagctcttgacattgaagaagga
gcagatattgtcatggtaaagccggcactttcttatcttgatattataaggcgggtaaag
gataatttcaacattcctattgctgcttataatgtaagtggagaatattcaatggtaaag
gcggcagctaagatgggttggattgatgaaaaatcggtagtcttagaaatactcacttca
attaaaagggcaggggcagacatagttataacctactttgcaaaggatgttgcaaaatgg
tttattaccctataa

DBGET integrated database retrieval system