KEGG   Thermoanaerobacter sp. X514: Teth514_0377Help
Entry
Teth514_0377      CDS       T00648                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tex00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
384831..385853
Genome map
AA seq 340 aa AA seqDB search
MLLKELTEIMGASGDEKEIREKIKSIVEPYVDNVYVDKIGNLIACKKGKKDKPKIMLAAH
MDEVGLMVKSVNEDGTLSFFPVGGVDNRILVAKTVKVGEKGINGVIGAKPIHLQKRDEQQ
KPLDFDSLYIDIGATSKEEALKHVSPGDYVYFDSNFEILGNGYVKAKALDDRIGCNVLIE
NLKNEYEYTVCAAFTVEEEVGLRGAGVAAYNVEPDFAIIVEGTVAADVTDSVPHLVSTEL
GKGPAISLMDRTTLYDKKLIDKIAKIADENKVPYQFRRIASGGNDAGKIHLTKGGIKTIA
VSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIEKEALI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaggaattgacagaaataatgggggcttcaggagatgagaaggagataagg
gagaagataaaaagtattgttgaaccatatgtggacaatgtttatgtagataaaataggg
aatttgatagcctgcaaaaaaggcaaaaaagacaaacctaaaataatgttagctgcccat
atggatgaagtaggacttatggtaaaatcagttaatgaagatgggactttgagttttttt
cctgtaggtggtgtagataatagaatactcgttgcaaaaacagtaaaagtaggtgaaaag
ggaataaatggagtaataggagcaaagccaatacaccttcaaaagagagacgaacagcaa
aagcctcttgacttcgattctctttatatagacattggtgcgacttcaaaagaagaagct
ttaaaacatgtttcccctggagattatgtttattttgactcaaattttgagatattagga
aatggctatgtgaaagcgaaggctttggatgacagaataggctgtaatgtgctgatagaa
aatctgaaaaacgagtatgaatatactgtttgtgcagcttttacagtggaggaggaagta
ggtttaaggggagcaggtgttgcagcatataatgtggaacccgactttgccataattgtg
gaagggacagttgcagcggatgttactgattcagtaccccatttagtttctacggaattg
ggcaagggacctgcaatttctttgatggacaggacaactctttatgataaaaaacttatt
gataaaattgcgaaaatagccgatgagaataaggtaccttatcaatttaggagaatagcc
agcggcggcaatgatgcagggaaaatccatcttacaaaaggtggcataaaaacaattgct
gtatctgtcccctgcaggtatattcattcttttaattctgtagcctttttagaagatttt
aataacacagttaaattggttgatttgataatcaaaaatattgaaaaggaggctttaata
tga

DBGET integrated database retrieval system