KEGG   Thermoanaerobacter sp. X514: Teth514_0599Help
Entry
Teth514_0599      CDS       T00648                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Teth514_0599 (ipk)
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Teth514_0599 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
623253..624122
Genome map
AA seq 289 aa AA seqDB search
MKKIKVKAYAKINLSLDVLGKRKDGYHEISTVMQSIDLADILEFEKSEIVKVFCSGHRVP
EGEDNLIVKVINFLKEKYQIEEGVLVRLDKKIPLAAGLAGGSADAAATIVALDKLWNLNM
SADEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLNVPHMNLLLVKPDIEIFTKKIYD
KWDRLNFKSHHATCSVVQAIQEGNIYKIAENIKNDLELVTSRECEVINQIKEELLKKGAL
GCAMSGSGPTVYGIFDDLQKLIKAYKNLEGIYSFVFFSKTIDKGLELYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaagtaaaggcctatgcaaaaatcaatttgtctttagacgtgctaggt
aagagaaaagatggatatcatgaaatttctacagtgatgcaatcaattgatttggctgat
attttagagtttgaaaaaagcgaaatagtcaaggttttttgtagtggccatcgagttcct
gaaggagaagataatttaatagtaaaggtcatcaactttttaaaagaaaaatatcaaata
gaagaaggagtgttagtcaggcttgacaagaaaatccctttagctgccggccttgctggg
ggaagtgctgatgctgctgctacaattgttgcattagacaaattatggaatttaaacatg
tcagcagatgagaaaaaagaaattgctttgaaagtgggagcagatgttcctttctgtctg
gaaggtgggacaaagcttgcaaaaggcataggggaaatttttgaagatttgaatgttcct
catatgaatttacttcttgtaaaacctgatattgaaattttcacaaaaaaaatttatgat
aaatgggataggcttaattttaaaagccatcatgctacttgttcagtagttcaagctata
caggaaggaaacatatacaaaattgcagaaaatataaaaaatgatttagaattagtaact
tctcgggaatgtgaagttattaatcaaataaaagaggagttgcttaaaaaaggtgcttta
ggatgtgctatgtcgggcagtggtcccactgtttatggaatttttgacgatttacaaaag
cttataaaagcctataaaaatttagaaggaatttacagttttgtatttttttcaaaaact
atagataaggggttagaattgtatgaatga

DBGET integrated database retrieval system