KEGG   Thermoanaerobacter sp. X514: Teth514_0667Help
Entry
Teth514_0667      CDS       T00648                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth514_0667 (gpmA)
   01230 Biosynthesis of amino acids
    Teth514_0667 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_0667 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Teth514_0667 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Teth514_0667 (gpmA)
Enzymes [BR:tex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Teth514_0667 (gpmA)
Exosome [BR:tex04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Teth514_0667 (gpmA)
  Exosomal proteins of melanoma cells
   Teth514_0667 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
701208..701963
Genome map
AA seq 251 aa AA seqDB search
MHKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKAEGYTFDCAFTSVLKR
AIRTLWIVLDELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSADVR
PPALEKDDPRYPGFDPRYADLSEEEIPLTENLIDTINRVIPYWESTIAPTIKSGKKVLIV
AHGNSLRGLVKYLDNLSKQEIMELNIPTGIPLVYELDDDLKPIRHYYLADEEKVKEKKEL
VENQGKIQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagttgttttgctaagacatggagaaagcctgtggaatatggaaaacagattt
actggctggacggatgttgatttatctccaaagggcattgaagaagctcgggaaagcggc
aagactttaaaggcagaagggtacacttttgactgtgcttttacttctgttttaaaaaga
gctataagaactttgtggattgttcttgacgaattagacaggatgtggataccggtttat
aaatcatggaggctcaatgaaaggcattatggagcactgcaagggcttaataaagctgag
accgccaagaaatacggagaagagcaggtaaaaatatggagaagatctgctgatgtaagg
cctcccgccttagaaaaagatgacccgagatatcccggttttgaccccagatatgctgac
ctttctgaggaagaaatcccccttactgaaaatttgattgatacaattaacagagttatt
ccatattgggagtccacaattgcaccgactataaaatcaggtaaaaaagtgctaatagtt
gctcatggaaatagtttgagagggcttgtaaaataccttgacaatctttctaagcaggag
ataatggagttaaatattcctacaggaattccgttagtttatgagcttgacgatgattta
aaacctataaggcattattatcttgccgatgaagagaaagtaaaagagaagaaagaatta
gtagaaaaccaaggaaagattcaagggaattcttaa

DBGET integrated database retrieval system