KEGG   Thermoanaerobacter sp. X514: Teth514_0813Help
Entry
Teth514_0813      CDS       T00648                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tex00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
845820..846320
Genome map
AA seq 166 aa AA seqDB search
MSEVYLSLGSNLGDREENLKRAVFELEHWEGIILKKLSPIYETKPVGYLNQDMFLNIAVE
VETNIGPYDLLKVVNEIEKKLKRERLIRWGPRTIDIDILLYDDIELKDEVLSIPHPRIWE
RAFVLIPLSDINPFIKKGDVYIKDLIAELPDKEGVKLYKENWYNGV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtgtatttatctttaggttctaatttaggagatagggaagaaaatttaaaa
agagccgtttttgagttagaacactgggaaggcataattttaaagaagctttctcctatt
tatgaaacaaaacctgtaggatatttaaaccaggatatgtttttaaatattgcagttgaa
gtggagacaaacattgggccttatgacttattaaaagttgtaaatgaaattgaaaaaaaa
ttaaaacgagaaagactcataagatggggtccaaggactattgatattgacatactgttg
tacgatgatattgaattaaaggatgaagtgttgagtattcctcatccgagaatatgggag
agagcttttgtgttgattcctctttcggatataaacccttttataaaaaaaggagatgtg
tatattaaagatttaatagcggagttgcctgataaagaaggagttaagctgtataaagag
aattggtacaatggggtgtaa

DBGET integrated database retrieval system