KEGG   Thermoanaerobacter sp. X514: Teth514_0844Help
Entry
Teth514_0844      CDS       T00648                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tex00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
881351..882808
Genome map
AA seq 485 aa AA seqDB search
MNNLRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKEFEELIFK
ELEWLGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKAYRCYCTPEELEEDRRK
AVERGDIPRYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEVIEFEDMIKGKITIKSDT
LGGDMVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPKFA
HAPLILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVEIMSKEEIIK
KFNFRRIHSANPVFDIEKLNWMNQQYIQKSSIERIVDLAIPHLRRAGYIDGIDDMVYNWL
KDVISLYKDGLQYVAQITEKAKMFFVEEVEYSDETVKILNSPNSKIVLEVVKKVIEEADE
ITEEYVKDLLKKLQKETKVKGKEFFMPIRVAITGEDHGPELVKIIPLLGKDKVINRLKKA
INLIK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttgagagttagatttgcgccaagcccaactggagctattcatatagggaat
ataagaactgctttatttaattatcttttttcaagaagtgaaggggctacttttgtttta
aggattgaagacacggacttagaaaggtcttcaaaagagtttgaagaattaatttttaaa
gaattagagtggttaggtatagaatgggacgaaggaccagataaaccaggtccctatggc
ccttataggcaaagtgaaagacttgaaatttatcataaatttgcccagaaacttattgaa
gaaaaaaaggcatatagatgttattgtactccggaggaattagaagaagatagaagaaag
gcagtagaaagaggagatatacctcgttattctggaaggtgtaggtatcttacaaaggag
caagaagaggcttttataagagagggaagaaaacctgtaataaggtttattattcctgac
gatgaagttatagagtttgaagacatgataaaaggaaaaattacaataaaaagtgatact
ttaggcggggacatggtaattgtcaaatcagacggaatgcctacttacaattttgcagtt
gtaatagatgacgctcttatgaagattacccatgtcataagaggagaagaccatatatac
aatactccgaaacagatactcatttacaaggctttaggatttgaaattcctaagtttgcc
catgcgcctttaatattgggaccagataggactaaactttctaaaaggcatgggaatact
tatataggccagtatagagaattgggatatttgccagaagctatgtttaactttttatct
cttttaagttggtcaccggaggataatgtagaaatcatgtcaaaagaagaaataataaag
aaatttaatttcagaaggattcacagtgctaatcctgtctttgatattgaaaagcttaat
tggatgaatcaacagtatatacaaaaaagttctattgagagaattgtagatttggctatt
ccacatttaagaagggcaggatacattgacggaatagatgatatggtgtataattggcta
aaggatgtaatatccctttacaaagatggactccaatatgtggctcaaattactgagaaa
gctaagatgttttttgtagaagaagttgagtattctgatgaaacggtgaaaatattgaat
agcccaaatagtaaaattgtactagaagtagttaaaaaagtcatagaggaagctgatgaa
ataacagaggaatatgttaaagatttgcttaaaaaattgcaaaaagaaaccaaggtaaaa
gggaaagaatttttcatgccaatcagagtagcaataacaggagaagaccatggacctgaa
ttggtgaagattattcctcttttggggaaggataaagtgataaataggctgaaaaaagcg
ataaatttaataaagtaa

DBGET integrated database retrieval system