KEGG   Thermoanaerobacter sp. X514: Teth514_0971Help
Entry
Teth514_0971      CDS       T00648                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_0971
   00030 Pentose phosphate pathway
    Teth514_0971
   00051 Fructose and mannose metabolism
    Teth514_0971
   00052 Galactose metabolism
    Teth514_0971
  Energy metabolism
   00680 Methane metabolism
    Teth514_0971
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Teth514_0971
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Teth514_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
990769..992013
Genome map
AA seq 414 aa AA seqDB search
MYTKSNCLIAQSGGPTAVINSSLYGAIMEASRSEKIGKVYGGINGIEGIIKGNIIDIFDI
PYERIKQMRFSPAAALGSCRYRLKDYLEDEEEYKKLIEIFKKYNIKYFFYIGGNDSMDAV
DKISKYAREIGFEINVIGIPKTIDNDLMFTDHSPGFGSAAKYIATTTLELALDAEVYETK
TINVLEVMGRNAGWLTASSALVKERLPHLKQLIYLPEIPFNEERFLEDVNKAYKEYGNVF
ITVSEGLMDEKGNYIGRKENAYHKDAFGHPQLGGVGDYIEKLVKEKIYKRVKMTRLGVTQ
RCAMHLASKVDFEEAEMLGREAVKYALCGETGKMISLVRERNYPYTVKTDIVDVDKVCNK
EKKMPLNWINEEGNYVTEEFFDYARPLIQGEVKVPMAEGLPYYINLKYAIKKQE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtatactaaaagcaattgtcttatagcacaatcaggtggtcctacagctgttattaat
tccagtctgtatggagctataatggaagcttcgcgctcggagaaaattggcaaagtttat
ggtgggataaacggcatagaaggtataataaaaggcaatattattgacatatttgatatt
ccctatgaaagaataaaacaaatgagatttagccctgcggctgcattagggtcgtgccga
tataggttaaaagactatttagaggatgaagaggaatacaaaaagttaatagaaattttt
aagaaatacaacattaaatattttttctacataggtggcaatgattctatggatgccgtt
gacaaaatcagtaaatatgcaagagaaataggttttgaaataaatgtaattggaattcct
aagactattgataacgatttgatgtttacagatcattctcctggttttggaagtgcggca
aaatatatagccacaactactttagaacttgctttagatgcggaagtgtatgagactaaa
acaattaacgtactcgaagtgatgggcagaaatgcaggttggcttaccgcttcttctgct
ttggttaaagaaagattgccccatttgaaacaacttatttatcttcctgagatacctttt
aatgaggaaagatttttagaggatgtaaataaagcttataaggaatatggcaatgtcttt
ataactgtgtcagaaggacttatggatgaaaaagggaattacattggaagaaaagaaaat
gcttatcataaagatgcttttggtcatcctcaactgggaggagtaggagactatatagaa
aagcttgtaaaagagaaaatatataaacgtgtcaaaatgaccagacttggtgtaacgcaa
agatgtgcaatgcacttggcatctaaagtggattttgaagaagctgaaatgttggggagg
gaagcagtaaagtatgcgttatgtggtgaaaccgggaaaatgataagccttgtaagagaa
agaaattacccatacactgttaaaacagatattgtagatgttgataaagtgtgtaacaag
gagaaaaaaatgcctttaaattggataaatgaagaaggtaattatgttactgaagaattt
tttgattatgcaagaccacttatacaaggagaagtgaaggtccctatggcagaagggtta
ccttattatataaacttaaaatatgcgataaaaaagcaggaataa

DBGET integrated database retrieval system