KEGG   Thermoanaerobacter sp. X514: Teth514_0971Help
Entry
Teth514_0971      CDS       T00648                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tex  Thermoanaerobacter sp. X514
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth514_0971
   01230 Biosynthesis of amino acids
    Teth514_0971
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth514_0971
   00030 Pentose phosphate pathway
    Teth514_0971
   00051 Fructose and mannose metabolism
    Teth514_0971
   00052 Galactose metabolism
    Teth514_0971
  Energy metabolism
   00680 Methane metabolism
    Teth514_0971
Enzymes [BR:tex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Teth514_0971
Protein phosphatases and associated proteins [BR:tex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Teth514_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
990769..992013
Genome map
AA seq 414 aa AA seqDB search
MYTKSNCLIAQSGGPTAVINSSLYGAIMEASRSEKIGKVYGGINGIEGIIKGNIIDIFDI
PYERIKQMRFSPAAALGSCRYRLKDYLEDEEEYKKLIEIFKKYNIKYFFYIGGNDSMDAV
DKISKYAREIGFEINVIGIPKTIDNDLMFTDHSPGFGSAAKYIATTTLELALDAEVYETK
TINVLEVMGRNAGWLTASSALVKERLPHLKQLIYLPEIPFNEERFLEDVNKAYKEYGNVF
ITVSEGLMDEKGNYIGRKENAYHKDAFGHPQLGGVGDYIEKLVKEKIYKRVKMTRLGVTQ
RCAMHLASKVDFEEAEMLGREAVKYALCGETGKMISLVRERNYPYTVKTDIVDVDKVCNK
EKKMPLNWINEEGNYVTEEFFDYARPLIQGEVKVPMAEGLPYYINLKYAIKKQE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtatactaaaagcaattgtcttatagcacaatcaggtggtcctacagctgttattaat
tccagtctgtatggagctataatggaagcttcgcgctcggagaaaattggcaaagtttat
ggtgggataaacggcatagaaggtataataaaaggcaatattattgacatatttgatatt
ccctatgaaagaataaaacaaatgagatttagccctgcggctgcattagggtcgtgccga
tataggttaaaagactatttagaggatgaagaggaatacaaaaagttaatagaaattttt
aagaaatacaacattaaatattttttctacataggtggcaatgattctatggatgccgtt
gacaaaatcagtaaatatgcaagagaaataggttttgaaataaatgtaattggaattcct
aagactattgataacgatttgatgtttacagatcattctcctggttttggaagtgcggca
aaatatatagccacaactactttagaacttgctttagatgcggaagtgtatgagactaaa
acaattaacgtactcgaagtgatgggcagaaatgcaggttggcttaccgcttcttctgct
ttggttaaagaaagattgccccatttgaaacaacttatttatcttcctgagatacctttt
aatgaggaaagatttttagaggatgtaaataaagcttataaggaatatggcaatgtcttt
ataactgtgtcagaaggacttatggatgaaaaagggaattacattggaagaaaagaaaat
gcttatcataaagatgcttttggtcatcctcaactgggaggagtaggagactatatagaa
aagcttgtaaaagagaaaatatataaacgtgtcaaaatgaccagacttggtgtaacgcaa
agatgtgcaatgcacttggcatctaaagtggattttgaagaagctgaaatgttggggagg
gaagcagtaaagtatgcgttatgtggtgaaaccgggaaaatgataagccttgtaagagaa
agaaattacccatacactgttaaaacagatattgtagatgttgataaagtgtgtaacaag
gagaaaaaaatgcctttaaattggataaatgaagaaggtaattatgttactgaagaattt
tttgattatgcaagaccacttatacaaggagaagtgaaggtccctatggcagaagggtta
ccttattatataaacttaaaatatgcgataaaaaagcaggaataa

DBGET integrated database retrieval system